Recombinant Macaca fascicularis Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)

In Stock
Code CSB-MP6125MOV
Abbreviation Recombinant Macaca fascicularis ITPRIPL1 protein, partial (Active)
MSDS
Size $136
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ITPRIPL1 at 2 μg/ml can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 3.759-4.428 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 3.759-4.428 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca fascicularis
Source
Mammalian cell
Expression Region
25-103aa
Target Protein Sequence
HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKQAAEQKQKAENFWRGDTSSDQLVLGKKDMGWPFQADGQEG
Mol. Weight
10.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

ITPRIPL1 interacts with inositol 1,4,5-trisphosphate receptors and participates in calcium signaling pathways, making it a valuable tool for dissecting intracellular calcium dynamics and receptor-mediated signaling events. This partial construct spanning residues 25–103 demonstrates robust antibody-binding activity in functional ELISA, achieving an EC50 of 3.759–4.428 ng/mL when immobilized at 2 μg/mL and tested against an anti-ITPRIPL1 recombinant antibody, confirming proper folding and epitope accessibility. Mammalian cell expression preserves native post-translational modifications critical for authentic protein-protein interactions, supporting its use in binding assays, antibody validation studies, and as a positive control in immunoassays targeting ITPRIPL1. The protein exceeds 95% purity by SDS-PAGE and contains less than 1.0 EU/μg endotoxin, meeting the quality thresholds commonly required for cell-based functional assays where low endotoxin levels are essential to avoid confounding inflammatory responses.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*