Recombinant Macaca fascicularis Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)

In Stock
Code CSB-MP6125MOV
Abbreviation Recombinant Macaca fascicularis ITPRIPL1 protein, partial (Active)
MSDS
Size $136
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ITPRIPL1 at 2 μg/ml can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 3.759-4.428 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 3.759-4.428 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca fascicularis
Source
Mammalian cell
Expression Region
25-103aa
Target Protein Sequence
HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKQAAEQKQKAENFWRGDTSSDQLVLGKKDMGWPFQADGQEG
Mol. Weight
10.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Macaca fascicularis ITPRIPL1 protein is an active, high-purity product synthesized in mammalian cells to ensure proper protein folding and native post-translational modifications. It includes amino acids 25 to 103 of the macaque ITPRIPL1 protein and carries a C-terminal 10xHis tag for efficient purification and detection. Supplied as a lyophilized powder, the recombinant ITPRIPL1 protein exhibits greater than 95% purity, confirmed by SDS-PAGE, and has low endotoxin levels, maintained below 1.0 EU/µg as determined by the LAL assay. Functional activity is verified in a binding ELISA, where immobilized ITPRIPL1 at 2 μg/mL shows specific interaction with the anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU), yielding an EC50 value between 3.759 and 4.428 ng/mL. These properties make the ITPRIPL1 protein a reliable tool for antibody screening, protein interaction studies, and functional research involving ITPRIPL1.

The ITPRIPL1 protein from Macaca fascicularis, also known as the cynomolgus macaque or long-tailed macaque, is part of the inositol 1,4,5-trisphosphate receptor (ITPR) family, which plays significant roles in calcium signaling pathways essential for various cellular processes. Although not extensively characterized in M. fascicularis, general research indicates that ITPR proteins are involved in intracellular calcium release, which is pertinent for muscle contraction, neurotransmitter release, and cell proliferation. Such functionality has been illustrated in several studies across different species, linking disruptions in calcium signaling to a range of physiological and pathological processes.

Research has shown that Macaca fascicularis has unique adaptations in their protein structures that could influence these signaling pathways. For example, studies into the evolutionary trajectories of Macaca species suggest potential variations in their receptor functionalities due to historical events such as hybridization and gene flow [1][2]. Such adaptations may affect the expression levels and activities of proteins like ITPRIPL1, potentially leading to different regulatory mechanisms compared to closely related primate species [2][3].

Additionally, the relevance of genetic studies on Macaca fascicularis is highlighted in the context of biomedical research. These animals are frequently used as non-human primate models to study human diseases, with an emphasis on understanding gene function and regulation [4][5]. Therefore, there are direct implications on how the expression and functionality of ITPRIPL1 may be utilized in modeling human pathologies, particularly those related to calcium signaling dysregulation, such as neurodegenerative diseases or cardiac dysfunctions [6].

The unique genomic characteristics of the M. fascicularis population contribute to their importance in biomedical research contexts. It is posited that proteins like ITPRIPL1 in cynomolgus macaques can assist in deciphering complex biological responses and may offer insights into therapeutic interventions for various diseases in humans, making research on such proteins critical [7][6].

References:
[1] D. Vanderpool, B. Minh, R. Lanfear, D. Hughes, S. Murali, R. Harriset al.Primate phylogenomics uncovers multiple rapid radiations and ancient interspecific introgression. Plos Biology, vol. 18, no. 12, p. e3000954, 2020. https://doi.org/10.1371/journal.pbio.3000954
[2] N. Osada, K. Matsudaira, Y. Hamada, & S. Malaivijitnond.Testing sex-biased admixture origin of macaque species using autosomal and x-chromosomal genomic sequences. Genome Biology and Evolution, 2020. https://doi.org/10.1093/gbe/evaa209
[3] Y. Hamada, A. San, & S. Malaivijitnond.Assessment of the hybridization between rhesus (macaca mulatta) and long‐tailed macaques (m. fascicularis) based on morphological characters. American Journal of Physical Anthropology, vol. 159, no. 2, p. 189-198, 2015. https://doi.org/10.1002/ajpa.22862
[4] J. Uli, C. Yong, et al. Rna sequencing (rna-seq) of lymph node, spleen, and thymus transcriptome from wild peninsular malaysian cynomolgus macaque (macaca fascicularis). Peerj, vol. 5, p. e3566, 2017. https://doi.org/10.7717/peerj.3566
[5] S. Laila, D. Astuti, I. Suparto, E. Handharyani, T. Register, & D. Sajuthi. Atherosclerotic lesion of the carotid artery in indonesian cynomolgus monkeys receiving a locally sourced atherogenic diet. Veterinary Sciences, vol. 9, no. 3, p. 105, 2022. https://doi.org/10.3390/vetsci9030105
[6] H. Darusman, S. Mariya, et al. Spontaneous expression of the gene of ki67 and p53 in cynomolgus monkeys infected with papillomavirus. Veterinary World, p. 962-967, 2022. https://doi.org/10.14202/vetworld.2022.962-967
[7] M. Abdul‐Latiff, F. Ruslin, H. Faiq, M. Salleh, J. Rovie‐Ryan, P. Abdul‐Patahet al.Continental monophyly and molecular divergence of peninsular malaysia’smacaca fascicularis fascicularis. Biomed Research International, vol. 2014, p. 1-18, 2014. https://doi.org/10.1155/2014/897682

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*