Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial

In Stock
Code CSB-EP3402GND
Abbreviation Recombinant SARS-CoV-2 Envelope small membrane protein&Membrane protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
E & M
Uniprot No.
Research Area
Immunology
Species
Severe acute respiratory syndrome coronavirus 2
Source
E.coli
Expression Region
P0DTC4(1-16)+P0DTC5(2-19)+P0DTC5(72-79)
Target Protein Sequence
MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M) is expressed in E. coli with an N-terminal 6xHis-SUMO tag. This partial protein covers the expression region from 1-42 amino acids and achieves a purity level of over 90% as verified by SDS-PAGE. This product is intended for research use only and does not contain endotoxin levels suitable for clinical applications.

The Envelope (E) and Membrane (M) proteins of Severe acute respiratory syndrome coronavirus 2 appear to play crucial roles in the virus's structure and life cycle. The E protein seems to be involved in virus assembly and release, while the M protein is likely integral to maintaining the virus's shape and size. Both proteins may prove essential for studying viral pathogenesis and developing potential therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Screening

This recombinant SARS-CoV-2 E&M protein fragment can serve as an immunogen or screening antigen for developing antibodies targeting the envelope and membrane proteins. The N-terminal 6xHis-SUMO tag makes purification and immobilization straightforward for ELISA-based antibody screening assays. The high purity (>90%) suggests reliable and reproducible results in antibody binding studies are achievable. This application could be particularly valuable for generating research tools to study coronavirus envelope and membrane protein interactions.

2. Protein-Protein Interaction Studies

The His-SUMO tagged protein can be used in pull-down assays to identify and characterize protein interactions involving the E and M protein domains. The His tag allows efficient immobilization on nickel-based resins for affinity purification experiments. Researchers might investigate how this partial protein fragment interacts with host cell proteins or other viral components in controlled in vitro conditions. The SUMO tag may also help with proper protein folding and solubility during interaction studies, though this remains to be validated experimentally.

3. Structural and Biochemical Characterization

This purified protein fragment provides material for biophysical and structural studies of the SARS-CoV-2 envelope and membrane protein regions. The high purity level suggests it could work well for techniques such as circular dichroism spectroscopy, dynamic light scattering, or NMR analysis to understand the protein's conformational properties. The defined expression region (1-42aa) allows for focused analysis of this specific domain's structural characteristics. Such studies might contribute to understanding the molecular basis of coronavirus envelope protein function.

4. ELISA-Based Binding Assays

The dual tag system (His-SUMO) enables versatile immobilization strategies for developing ELISA-based research assays. The protein can be used to study binding interactions with potential research compounds, other viral proteins, or cellular receptors in a controlled plate-based format. The high purity appears to ensure consistent coating and reliable quantitative measurements in binding studies. This application supports screening efforts for research tools targeting coronavirus envelope and membrane proteins.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*