Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial

In Stock
Code CSB-EP3402GND
Abbreviation Recombinant SARS-CoV-2 Envelope small membrane protein&Membrane protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
E & M
Uniprot No.
Research Area
Immunology
Species
Severe acute respiratory syndrome coronavirus 2
Source
E.coli
Expression Region
P0DTC4(1-16)+P0DTC5(2-19)+P0DTC5(72-79)
Target Protein Sequence
MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M) is expressed in E. coli with an N-terminal 6xHis-SUMO tag. This partial protein covers the expression region from 1-42 amino acids and achieves a purity level of over 90% as verified by SDS-PAGE. This product is intended for research use only and does not contain endotoxin levels suitable for clinical applications.

The Envelope (E) and Membrane (M) proteins of Severe acute respiratory syndrome coronavirus 2 appear to play crucial roles in the virus's structure and life cycle. The E protein seems to be involved in virus assembly and release, while the M protein is likely integral to maintaining the virus's shape and size. Both proteins may prove essential for studying viral pathogenesis and developing potential therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in E. coli as a partial fragment (1–389 aa) of SARS-CoV-2 envelope (E) and membrane (M) proteins, tagged with an N-terminal 6xHis-SUMO motif. While the SUMO tag enhances solubility, E. coli struggles to correctly fold eukaryotic membrane proteins (E and M are integral membrane proteins with complex topology). No data confirms native secondary/tertiary structure (e.g., circular dichroism, thermal shift assays). E. coli may misfold the fragment, leading to aggregation or non-functional conformations. The fragment lacks full-length context (e.g., transmembrane domains, interaction motifs for other viral proteins like Spike [S] or host factors). Bioactivity (e.g., membrane association, protein-protein interactions) is untested and unlikely to mimic native E/M function.

1. Antibody Development and Screening

This recombinant E&M fragment can serve as an immunogen for generating antibodies, but antibody specificity must be validated against native E/M—E. coli-expressed protein may present non-native epitopes, leading to cross-reactivity with irrelevant targets. The His-SUMO tag simplifies purification/immobilization for ELISA, but antibodies may not recognize the fragment in its native context (e.g., on viral particles).

2. Protein-Protein Interaction Studies

Pull-down assays using the His-SUMO tag can identify interactors, but results depend on correct folding—E. coli-expressed fragments often misfold, causing false positives/negatives. Identified partners must be validated via co-IP or functional assays to rule out artifacts. The partial length restricts insights to interactions within this domain, not full-length E/M biology.

3. Structural and Biochemical Characterization

This fragment supports preliminary biophysical studies (e.g., CD for secondary structure, DLS for stability) but cannot inform native E/M architecture—E. coli-expressed protein may lack correct disulfide bonds or transmembrane folding. Structural conclusions (e.g., oligomerization) must be contextualized by folding limitations.

4. ELISA-Based Binding Assays

The His-SUMO tag enables immobilization for ELISA, but misfolding may alter binding—results are qualitative at best. Quantitative affinity measurements require a confirmed native structure, as the fragment’s conformation may not support native-like interactions.

Final Recommendation & Action Plan

This E. coli-expressed SARS-CoV-2 E&M fragment has limited utility without rigorous validation: first, confirm folding via CD spectroscopy and thermal shift assays to rule out misfolding; second, test bioactivity (e.g., membrane association or interaction with Spike) to ensure native-like function. Optimize expression (e.g., co-express chaperones, use low-temperature induction) to improve solubility. For antibody development, validate specificity against native E/M; for interactions/ELISA, use tag cleavage or orthogonal methods (e.g., SPR) to reduce artifacts. If folding/bioactivity fails, use a eukaryotic system (e.g., mammalian/insect cells) to ensure native structure—this fragment alone is insufficient for reliable downstream applications without validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*