SLC25A51 Antibody

Code CSB-PA875649LA01HU
Size US$166
Order now
Image
  • IHC image of CSB-PA875649LA01HU diluted at 1:300 and staining in paraffin-embedded human endometrial cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.05% DAB. Secondary antibody only control: uses 1% BSA instead of primary antibody
Promotion Free Antibody trial simple
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Full Product Name
Rabbit anti-Homo sapiens (Human) SLC25A51 Polyclonal antibody
Uniprot No.
Target Names
SLC25A51
Alternative Names
SLC25A51; MCART1; Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51; Mitochondrial NAD(+ transporter SLC25A51; Mitochondrial carrier triple repeat protein 1; Solute carrier family 25 member 51
Raised in
Rabbit
Species Reactivity
Human
Immunogen
Recombinant Human Solute carrier family 25 member 51 protein (1-35AA)
Immunogen Species
Homo sapiens (Human)
Conjugate
Non-conjugated

The SLC25A51 Antibody (Product code: CSB-PA875649LA01HU) is Non-conjugated. For SLC25A51 Antibody with conjugates, please check the following table.

Available Conjugates
Conjugate Product Code Product Name Application
HRP CSB-PA875649LB01HU SLC25A51 Antibody, HRP conjugated ELISA
FITC CSB-PA875649LC01HU SLC25A51 Antibody, FITC conjugated
Biotin CSB-PA875649LD01HU SLC25A51 Antibody, Biotin conjugated ELISA
Clonality
Polyclonal
Isotype
IgG
Purification Method
>95%, Protein G purified
Concentration
It differs from different batches. Please contact us to confirm it.
Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, PH 7.4
Form
Liquid
Tested Applications
ELISA, IHC
Recommended Dilution
Application Recommended Dilution
IHC 1:200-1:500
Troubleshooting and FAQs
Storage
Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Description

The SLC25A51 polyclonal antibody was generated in a rabbit by injecting the recombinant human solute carrier family 25 member 51 protein (1-35aa), triggering an immune response. After collection of the resulting rabbit blood, protein G affinity chromatography was performed to refine the SLC25A51 polyclonal antibody, resulting in a purity level of more than 95%.

This high-purity SLC25A51 antibody has been shown to react with both human and mouse samples and has undergone thorough validation for use in WB, IF, and IHC applications, allowing for the detection of the presence of SLC25A51 protein and visualization of its distribution and localization.

Usage
For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 2 reviews

Submit a Review here

Applications : IF

Sample type: Human HeLa cells

Review: Super-resolution microscopy revealed that MCART1 lo calizes to the inner mitochondrial membrane, consistent with a function in transporting a metabolite into mitochondria.

By Anonymous

Applications : Western Blot

Sample type: cell

Review: Western blot analysis of mitochondrial proteins levels of wild type and SLC25A51 knockdown HCT116 cells treated with aspirin (1 mM) or DMSO for 24 hours.

By Anonymous

 Q&A
Q:

May I get a free trial of the antibody CSB-PA875649LA01HU before I commit to buying a full size?

A:

Regarding your inquiry, the immunogen of CSB-PA875649LA01HU is Recombinant Human Solute carrier family 25 member 51 protein (1-35AA)and the immunogen sequence is MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYL.

And for this antibody, we can offer a free trial sample (CSB-PA875649LA01HU with 20ug*1) before you place full size order.

Target Background

Function
Mitochondrial membrane carrier protein that mediates the import of NAD(+) into mitochondria. Mitochondrial NAD(+) is required for glycolysis and mitochondrial respiration. Compared to SLC25A52, SLC25A51-mediated transport is essential for the import of NAD(+) in mitochondria.
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Database Links

HGNC: 23323

KEGG: hsa:92014

STRING: 9606.ENSP00000242275

UniGene: Hs.634120

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*