| Code | CSB-PA875649LA01HU |
| Size | US$166 |
| Order now | |
| Image |
|
| Promotion | ![]() |
| Have Questions? | Leave a Message or Start an on-line Chat |
The SLC25A51 Antibody (Product code: CSB-PA875649LA01HU) is Non-conjugated. For SLC25A51 Antibody with conjugates, please check the following table.
| Application | Recommended Dilution |
|---|---|
| IHC | 1:200-1:500 |
The SLC25A51 polyclonal antibody was generated in a rabbit by injecting the recombinant human solute carrier family 25 member 51 protein (1-35aa), triggering an immune response. After collection of the resulting rabbit blood, protein G affinity chromatography was performed to refine the SLC25A51 polyclonal antibody, resulting in a purity level of more than 95%.
This high-purity SLC25A51 antibody has been shown to react with both human and mouse samples and has undergone thorough validation for use in WB, IF, and IHC applications, allowing for the detection of the presence of SLC25A51 protein and visualization of its distribution and localization.
Applications : IF
Sample type: Human HeLa cells
Review: Super-resolution microscopy revealed that MCART1 lo calizes to the inner mitochondrial membrane, consistent with a function in transporting a metabolite into mitochondria.
By Anonymous
Applications : Western Blot
Sample type: cell
Review: Western blot analysis of mitochondrial proteins levels of wild type and SLC25A51 knockdown HCT116 cells treated with aspirin (1 mM) or DMSO for 24 hours.
By Anonymous
May I get a free trial of the antibody CSB-PA875649LA01HU before I commit to buying a full size?
Regarding your inquiry, the immunogen of CSB-PA875649LA01HU is Recombinant Human Solute carrier family 25 member 51 protein (1-35AA)and the immunogen sequence is MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYL.
And for this antibody, we can offer a free trial sample (CSB-PA875649LA01HU with 20ug*1) before you place full size order.