Home
Protein
Recombinant Proteins
Recombinant Mycobacterium bovis Alpha-crystallin (hspX)

Recombinant Mycobacterium bovis Alpha-crystallin (hspX)

^{In Stock}

Code	CSB-BP358651MVH
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

hspX

Uniprot No.

P0A5B8

Research Area

Others

Alternative Names

hspX; BQ2027_MB2057C14 kDa antigen; 16 kDa antigen; HSP 16.3

Species

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Source

Baculovirus

Expression Region

2-144aa

Target Protein Sequence

ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 9xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene responsible for the Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) hspX protein (2-144aa) is cloned into a plasmid vector to obtain recombinant plasmid, which is then transformed into baculovirus cells. baculovirus cells demonstrating successful uptake of the recombinant plasmid are selected based on their ability to endure a specific antibiotic. The baculovirus cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. The protein carries a C-terminal 9xHis tag. Post-expression, affinity purification is employed to isolate and purify the recombinant Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) hspX protein from the cell lysate. The resulting recombinant protein is subjected to denaturing SDS-PAGE, allowing for an estimation of its purity, surpassing 85%.