Recombinant Mycobacterium bovis 14 kDa antigen(hspX)

In Stock
Code CSB-BP358651MVH
Product Type Recombinant Protein
Size US$330Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P0A5B8
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Research Area Others
Source Baculovirus
Gene Names hspX
Protein Names 16 kDa antigen HSP 16.3
Expression Region 2-144aa
Tag Info C-terminal 9xHis-tagged
Mol. Weight 18.1 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted, cell wall
Protein Families Small heat shock protein (HSP20) family

Related Products

hspX Antibodies

hspX Antibodies for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

hspX Proteins

hspX Proteins for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.