Recombinant Mycobacterium bovis Alpha-crystallin (hspX)

In Stock
Code CSB-BP358651MVH
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
hspX
Uniprot No.
Research Area
Others
Alternative Names
hspX; BQ2027_MB2057C14 kDa antigen; 16 kDa antigen; HSP 16.3
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Source
Baculovirus
Expression Region
2-144aa
Target Protein Sequence
ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
18.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 9xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene responsible for the Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) hspX protein (2-144aa) is cloned into a plasmid vector to obtain recombinant plasmid, which is then transformed into baculovirus cells. baculovirus cells demonstrating successful uptake of the recombinant plasmid are selected based on their ability to endure a specific antibiotic. The baculovirus cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. The protein carries a C-terminal 9xHis tag. Post-expression, affinity purification is employed to isolate and purify the recombinant Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) hspX protein from the cell lysate. The resulting recombinant protein is subjected to denaturing SDS-PAGE, allowing for an estimation of its purity, surpassing 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a chaperone.
Subcellular Location
Secreted, cell wall. Cytoplasm.
Protein Families
Small heat shock protein (HSP20) family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*