Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-BP358651MVH |
| Product Type | Recombinant Protein |
| Size |
US$330Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P0A5B8 |
| Lead Time | 3-7 business days |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN |
| Research Area | Others |
| Source | Baculovirus |
| Gene Names | hspX |
| Protein Names | 16 kDa antigen HSP 16.3 |
| Expression Region | 2-144aa |
| Tag Info | C-terminal 9xHis-tagged |
| Mol. Weight | 18.1 kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Subcellular Location | Secreted, cell wall |
| Protein Families | Small heat shock protein (HSP20) family |
hspX Antibodies for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA358651ZA01MVH | hspX Antibody | Mycobacterium bovis | ELISA, WB (ensure identification of antigen) |
hspX Proteins for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP358651MVH | Recombinant Mycobacterium bovis 14 kDa antigen(hspX) | Yeast |
| CSB-EP358651MVH | Recombinant Mycobacterium bovis 14 kDa antigen(hspX) | E.coli |
| CSB-MP358651MVH |
Recombinant Mycobacterium bovis 14 kDa antigen(hspX) | Mammalian cell |
Recombinant Human UV excision repair protein RAD23 homolog A(RAD23A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Fibroblast growth factor receptor 1(FGFR1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Regenerating islet-derived protein 3-gamma(Reg3g)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial(Cyp27b1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Cell cycle checkpoint protein RAD1(RAD1)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
