Recombinant Escherichia coli Cytolethal distending toxin subunit B (cdtB)

In Stock
Code CSB-EP671598ENL
Abbreviation Recombinant E.coli cdtB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
cdtB
Uniprot No.
Research Area
others
Alternative Names
cdtBCytolethal distending toxin subunit B; CDT B; Deoxyribonuclease CdtB; EC 3.1.-.-
Species
Escherichia coli
Source
E.coli
Expression Region
19-269aa
Target Protein Sequence
DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding the cytolethal distending toxin (CDT) recombinant protein A,B,C.
(https://www.cusabio.com/Recombinant-Protein/Recombinant-Escherichia-coli-Cytolethal-distending-toxin-subunit-BcdtB-12102551.html)
1. May I know if there is any difference in activity between CDT recombinant protein from E.coli vs mammalian cell?
Will the recombinant protein produced from mammalian cells be more active/ genotoxic?
2. Could you give more information on the measurement of activity of CDT?
3. Does any publication use the CDT recombinant protein from Cusabio before?
4. Is there endotoxin test conducted on these CDT recombinant protein? Are they low in endotoxin?
5. May I know what other recombinant protein that i can use as a negative control?

A:
Thanks for your inquiry.
1. This protein is Bacteroides fragilis, protein from E.coli expression system maybe more suitable.
2. Regarding activity, we didn't test activity of this protein, cannot 100% guaranteed. But what we provide is the full length of mature protein, which is purified under mild condition, it is active in theory.
3. Currently, there is no publication of this product.
4. We could provide endotoxin removal service, and the protein will be low in endotoxin.
5. Could you please tell what experiment you will use this protein for? What kind of negtive control you need?
Q:

I want to clarify some details:
· Are the samples all derived from E. coli?
· Are the proteins supplied in powder form?

A:
Thanks for your inquiry. Our response is as below. · Are the samples all derived from E. coli?
Yes, they are.

· Are the proteins supplied in powder form?
The protein will be supplied in liquid form.
The protein concentration is 1.5mg/ml. The storage buffer is 20 mM Tris-HCl, 0.5M NaCl, pH 8.0,50% glycerin.

Target Background

Function
Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement.
Subcellular Location
Secreted. Note=Localized to the nucleus of the infected cells.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*