Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
caf1; YPMT1.84; Y1100; YP_pMT082F1 capsule antigen
Expression Region
22-170aa
Target Protein Sequence
ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Yersinia pestis caf1 contains amino acids 22-170. This caf1 protein is theoretically predicted to have a molecular weight of 19.6 kDa. Expression of this caf1 protein is conducted in e.coli. The N-terminal 6xHis tag was smoothly integrated into the coding gene of caf1, which enables a simple process of detecting and purifying the caf1 recombinant protein in the following steps.
The Yersinia pestis F1 capsule antigen, encoded by the caf1 gene, is a key virulence factor produced by the bacterium Yersinia pestis, which is responsible for causing bubonic, septicemic, and pneumonic plague. The caf1 is a major component of the bacterial capsule that surrounds the cell surface, protecting the host's immune responses. The caf1 is an antiphagocytic structure that helps Yersinia pestis evade detection and destruction by the host's immune system. It plays a crucial role in the pathogenesis of plague by preventing phagocytosis of the bacteria by host macrophages and neutrophils. Studies on the Yersinia pestis caf1 have been fundamental for understanding the pathogenic mechanisms of plague and have contributed to the development of potential vaccine candidates.
