Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

caf1

Uniprot No.

P26948

Research Area

others

Alternative Names

caf1; YPMT1.84; Y1100; YP_pMT082F1 capsule antigen

Species

Yersinia pestis

Source

E.coli

Expression Region

22-170aa

Target Protein Sequence

ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Yersinia pestis caf1 contains amino acids 22-170. This caf1 protein is theoretically predicted to have a molecular weight of 19.6 kDa. Expression of this caf1 protein is conducted in e.coli. The N-terminal 6xHis tag was smoothly integrated into the coding gene of caf1, which enables a simple process of detecting and purifying the caf1 recombinant protein in the following steps.

The Yersinia pestis F1 capsule antigen, encoded by the caf1 gene, is a key virulence factor produced by the bacterium Yersinia pestis, which is responsible for causing bubonic, septicemic, and pneumonic plague. The caf1 is a major component of the bacterial capsule that surrounds the cell surface, protecting the host's immune responses. The caf1 is an antiphagocytic structure that helps Yersinia pestis evade detection and destruction by the host's immune system. It plays a crucial role in the pathogenesis of plague by preventing phagocytosis of the bacteria by host macrophages and neutrophils. Studies on the Yersinia pestis caf1 have been fundamental for understanding the pathogenic mechanisms of plague and have contributed to the development of potential vaccine candidates.

Code	CSB-EP338792YAS
Abbreviation	Recombinant Yersinia pestis caf1 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Yersinia pestis F1 capsule antigen (caf1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage