Recombinant Shigella flexneri Invasin IpaD(ipaD)

In Stock
Code CSB-EP325954SZB
Size US$2466 How to order?
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

Recombinant Shigella flexneri Invasin Ipad with an N-terminal 10xHis-SUMO-tag and a C-terminal Myc-tag is a full-length of protein expressed in E.coli. The sequence used to prepare this recombinant Ipad protein corresponds to residues Met1-Phe332 of Shigella flexneri Ipad. Its purity is greater than 90% determined by SDS-PAGE. A molecular mass band of approximately 50-62 kDa was visualized on the gel under reducing conditions. In-stock Ipad proteins are offered. This recombinant Ipad protein may be used to produce antibodies against Ipad or in the studies of Ipad-related microbiology.

Invasion plasmid antigen D (Ipad) is a structural component that forms a complex at the tip of the Shigella type III secretion system (T3SS) apparatus needle. It is one of the predominant virulence factors of Shigella flexneri. Olivia Arizmendi etc. demonstrated that Ipad triggers apoptosis in macrophages through activation of host caspases accompanied by mitochondrial disruption during Shigella flexneri infection. And the N-terminal domain of the Ipad is necessary for macrophage killing.

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ipaD
Uniprot No. P18013
Research Area Microbiology
Alternative Names ipaD; CP0126; Invasin IpaD; 36 kDa membrane antigen
Species Shigella flexneri
Source E.coli
Expression Region 1-332aa
Target Protein Sequence MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 56.6kDa
Protein Length Full Length
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for bacterial invasion of host cells. Controls IpaB and IpaC secretion, and the efficiency with which they are physically inserted into target cell membranes. These proteins are exported via TTSS to form a pore in the host membrane that allows the translocation of the other effectors into the host cytoplasm. Along with IpaB, is essential for both blocking secretion through the Mxi/Spa translocon in the absence of a secretion-inducing signal, and for controlling the level of secretion in the presence of this signal.
Gene References into Functions
  1. IpaD, the putative needle-tip protein of the S. flexneri type III secretion system, has been crystallized; in-drop proteolysis resulted in the production of several new crystal forms. PMID: 16946465
  2. IpaD forms part of the structure at the needle tip in Shigella flexner and antibodiesblock entry of bacteria into epithelial cells. PMID: 17110044
Subcellular Location Secreted. Note=Secreted via the type III secretion system (TTSS). Localizes to the tip of the external secretion needle that is part of the TTSS apparatus.
Protein Families Invasin protein D family
Database Links

KEGG: sfl:CP0126

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1