Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ipaD

Uniprot No.

P18013

Research Area

Microbiology

Alternative Names

ipaD; CP0126; Invasin IpaD; 36 kDa membrane antigen

Species

Shigella flexneri

Source

E.coli

Expression Region

1-332aa

Target Protein Sequence

MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

56.6kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Shigella flexneri Invasin Ipad with an N-terminal 10xHis-SUMO-tag and a C-terminal Myc-tag is a full-length of protein expressed in E.coli. The sequence used to prepare this recombinant Ipad protein corresponds to residues Met1-Phe332 of Shigella flexneri Ipad. Its purity is greater than 90% determined by SDS-PAGE. A molecular mass band of approximately 50-62 kDa was visualized on the gel under reducing conditions. In-stock Ipad proteins are offered. This recombinant Ipad protein may be used to produce antibodies against Ipad or in the studies of Ipad-related microbiology.

Invasion plasmid antigen D (Ipad) is a structural component that forms a complex at the tip of the Shigella type III secretion system (T3SS) apparatus needle. It is one of the predominant virulence factors of Shigella flexneri. Olivia Arizmendi etc. demonstrated that Ipad triggers apoptosis in macrophages through activation of host caspases accompanied by mitochondrial disruption during Shigella flexneri infection. And the N-terminal domain of the Ipad is necessary for macrophage killing.

Target Background

Function

Required for bacterial invasion of host cells. Controls IpaB and IpaC secretion, and the efficiency with which they are physically inserted into target cell membranes. These proteins are exported via TTSS to form a pore in the host membrane that allows the translocation of the other effectors into the host cytoplasm. Along with IpaB, is essential for both blocking secretion through the Mxi/Spa translocon in the absence of a secretion-inducing signal, and for controlling the level of secretion in the presence of this signal.

Gene References into Functions

IpaD, the putative needle-tip protein of the S. flexneri type III secretion system, has been crystallized; in-drop proteolysis resulted in the production of several new crystal forms. PMID: 16946465
IpaD forms part of the structure at the needle tip in Shigella flexner and antibodiesblock entry of bacteria into epithelial cells. PMID: 17110044

Subcellular Location

Secreted. Note=Secreted via the type III secretion system (TTSS). Localizes to the tip of the external secretion needle that is part of the TTSS apparatus.

Protein Families

Invasin protein D family

Database Links

KEGG: sfl:CP0126

Code	CSB-EP325954SZB
Abbreviation	Recombinant Shigella flexneri ipaD protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Shigella flexneri Invasin IpaD (ipaD)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage