Recombinant Streptomyces avidinii Streptavidin

In Stock
Code CSB-EP332849SNO
Abbreviation Recombinant Streptomyces avidinii Streptavidin protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
; Streptavidin
Species
Streptomyces avidinii
Source
E.coli
Expression Region
25-183aa
Target Protein Sequence
DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Streptomyces avidinii Streptavidin is produced in E.coli and contains the full length mature protein, spanning amino acids 25-183. The protein carries an N-terminal GST tag for easier purification and detection. SDS-PAGE analysis confirms purity levels above 90%, which appears to make it suitable for research applications that demand high-quality protein standards.

Streptavidin from Streptomyces avidinii has gained popularity in research primarily because of its strong affinity for biotin. This interaction forms one of the strongest known non-covalent bonds. Such robust binding makes the protein particularly valuable in biochemical assays - especially those involving purification, detection, and immobilization of biotinylated molecules. The protein's ability to mediate these interactions may explain its widespread adoption in molecular biology and biotechnology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Streptavidin from Streptomyces avidinii is a bacterial protein that naturally forms a tetramer with extremely high biotin-binding affinity. The E. coli expression system is generally compatible with bacterial proteins, and streptavidin has been successfully expressed in E. coli in many studies. However, the N-terminal GST tag (∼26 kDa) is significantly larger than the streptavidin monomer (∼13 kDa) and may sterically interfere with proper tetramer formation, which is essential for high-affinity biotin binding. While the protein may be soluble, the probability of correct tetramerization and functional activity is moderate but requires experimental validation due to potential tag interference.

1. Biotin-Binding Affinity Studies

This application is conditionally suitable but requires validation. If the protein achieves proper tetramerization despite the GST tag, it could be used for biotin-binding studies. However, the large GST tag may sterically hinder the biotin-binding pocket or prevent correct tetramer formation, leading to significantly reduced binding affinity or false-negative results. Surface plasmon resonance or fluorescence polarization assays should include positive controls to validate binding capability.

2. GST Pull-Down Assay Development

This application is highly suitable as it leverages the GST tag directly. The protein can be immobilized on glutathione resins to capture biotinylated molecules. Even if biotin-binding affinity is reduced, the GST tag functionality remains intact for pull-down applications. This approach is valuable for isolating biotinylated targets from complex mixtures.

3. Comparative Structural and Biochemical Analysis

This application is conditionally suitable for biochemical comparisons but is limited for structural studies. The GST tag may alter thermal stability and oligomeric state measurements. Comparative analyses should focus on sequence-based comparisons rather than structural or functional comparisons with native streptavidins.

4. Biotinylation System Validation

This application is not recommended without prior validation of biotin-binding functionality. If the protein has impaired biotin binding due to the GST tag, it will yield false-negative results in validation assays. A tag-free streptavidin control is essential for reliable validation.

Final Recommendation & Action Plan

This GST-tagged streptavidin is primarily suitable for applications leveraging the GST tag functionality but requires rigorous validation for biotin-binding studies. The immediate priority is to test biotin-binding activity using a standard assay (e.g., HABA assay or SPR) to determine if the tag interferes with function. If binding activity is confirmed, proceed with Application 1 cautiously. Application 2 (GST pull-downs) can proceed immediately regardless of biotin-binding status. Application 3 should be limited to sequence-based comparisons. Avoid Application 4 unless biotin-binding is validated. For critical biotin-binding applications, consider tag removal or use commercial tag-free streptavidin. This systematic approach ensures appropriate use based on functional validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).
Subcellular Location
Secreted.
Protein Families
Avidin/streptavidin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*