Home
Protein
Recombinant Proteins
Recombinant Bacillus cereus 1-phosphatidylinositol phosphodiesterase

Recombinant Bacillus cereus 1-phosphatidylinositol phosphodiesterase

^{In Stock}

Code	CSB-YP321220BQJ
Abbreviation	Recombinant 1-phosphatidylinositol phosphodiesterase protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P14262

Research Area

Others

Species

Bacillus cereus

Source

Yeast

Expression Region

32-329aa

Target Protein Sequence

ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLIKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

36.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Bacillus cereus 1-phosphatidylinositol phosphodiesterase is produced in yeast using an expression construct that encodes the full-length mature 1-phosphatidylinositol phosphodiesterase, comprising amino acids 32 to 329. A C-terminal 6xHis-tag is included in the construct, enabling efficient purification and detection of the recombinant 1-phosphatidylinositol phosphodiesterase. The purity of the recombinant 1-phosphatidylinositol phosphodiesterase exceeds 90%, as confirmed by SDS-PAGE analysis. On the gel, this protein migrates as a band with an approximate molecular weight of 36 kDa.

The Bacillus cereus 1-phosphatidylinositol phosphodiesterase mainly catalyzes the hydrolysis of 1-phosphatidylinositol (PI) molecules to produce inositol phosphate and diacylglycerol (DAG). It plays a crucial role in lipid metabolism, cellular signaling, and modulation of intracellular processes.