Recombinant Abrus precatorius Abrin-a, partial

In Stock
Code CSB-EP319970AAC
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP319970AAC could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP319970AAC could indicate that this peptide derived from E.coli-expressed Abrus precatorius (Indian licorice) (Glycine abrus) N/A.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Abrin-a [Cleaved into: Abrin-a A chain; EC 3.2.2.22; rRNA N-glycosidase); Linker peptide; Abrin-a B chain]
Species
Abrus precatorius (Indian licorice) (Glycine abrus)
Source
E.coli
Expression Region
1-251aa
Target Protein Sequence
QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
33.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Abrus precatorius Abrin-a generation initiates with isolating the target gene corresponding to the Abrus precatorius Abrin-a (1-251aa). This gene is co-cloned into an expression vector with an N-terminal 10xHis-tag gene and introduced into E. coli cells via transformation. The positive E. coli cells are induced to express the recombinant protein, which is harvested from the cell lysate. The protein is purified using affinity chromatography. Its purity is over 85% as determined by SDS-PAGE.

Abrin-a is a protein toxin derived from the seeds of the plant Abrus precatorius, commonly known as jequirity beans or rosary peas. This toxin is a type II ribosome-inactivating protein that inhibits protein synthesis in eukaryotic cells, leading to cell death [1][2][3][4][5][6][7]. Structurally and functionally, abrin-a is similar to ricin, a protein toxin found in castor beans [8]. It acts as a ribosome inhibitory protein, with an enzymatic A chain linked to a B chain, which has specificity to terminal galactose [3]. Abrin-a has gained attention due to its potential malevolent use and is of concern as a biothreat agent [9]. The toxin triggers apoptosis in cells by inhibiting protein synthesis, leading to the unfolded protein response [4]. Additionally, abrin-a has been the focus of research for developing detection methods, quantification techniques, and even post-exposure protection strategies against its toxicity [5][10].

References:
[1] B. Hovde, H. Daligault, E. Hanschen, Y. Kunde, M. Johnson, S. Starkenburget al., Detection of abrin-like and prepropulchellin-like toxin genes and transcripts using whole genome sequencing and full-length transcript sequencing of abrus precatorius, Toxins, vol. 11, no. 12, p. 691, 2019. https://doi.org/10.3390/toxins11120691
[2] A. Bagaria, K. Surendranath, U. Ramagopal, S. Ramakumar, & A. Karande, Structure-function analysis and insights into the reduced toxicity of abrus precatorius agglutinin i in relation to abrin, Journal of Biological Chemistry, vol. 281, no. 45, p. 34465-34474, 2006. https://doi.org/10.1074/jbc.m601777200
[3] S. Gadadhar and A. Karande, Abrin immunotoxin: targeted cytotoxicity and intracellular trafficking pathway, Plos One, vol. 8, no. 3, p. e58304, 2013. https://doi.org/10.1371/journal.pone.0058304
[4] R. Mishra, M. Kumar, & A. Karande, Inhibition of protein synthesis leading to unfolded protein response is the major event in abrin-mediated apoptosis, Molecular and Cellular Biochemistry, vol. 403, no. 1-2, p. 255-265, 2015. https://doi.org/10.1007/s11010-015-2355-9
[5] S. Livet, S. Worbs, H. Volland, S. Simon, M. Dorner, F. Fenailleet al., Development and evaluation of an immuno-maldi-tof mass spectrometry approach for quantification of the abrin toxin in complex food matrices, Toxins, vol. 13, no. 1, p. 52, 2021. https://doi.org/10.3390/toxins13010052
[6] J. Wooten, C. Pittman, T. Blake, J. Thomas, J. Devlin, R. Higgersonet al., A case of abrin toxin poisoning, confirmed via quantitation of l-abrine (n-methyl-l-tryptophan) biomarker, Journal of Medical Toxicology, vol. 10, no. 4, p. 392-394, 2014. https://doi.org/10.1007/s13181-013-0377-9
[7] S. Banger, R. Singh, N. Tripathi, V. Pal, & A. Goel, One step purification and characterisation of abrin toxin from abrus precatorius seeds, Defence Life Science Journal, vol. 4, no. 4, p. 231-235, 2019. https://doi.org/10.14429/dlsj.4.14967
[8] M. Kumar, P. Dinkar, H. Abbas, & E. Chaudhary, Fatal curiosity: a case of suicidal attempt by abrus seeds consumption through online research, Cureus, 2023. https://doi.org/10.7759/cureus.38458
[9] A. Dodge, K. Carrasquillo, L. Rivera, X. Lei, L. Wackett, & M. Sadowsky, Rapid method using two microbial enzymes for detection of l-abrine in food as a marker for the toxic protein abrin, Applied and Environmental Microbiology, vol. 81, no. 5, p. 1610-1615, 2015. https://doi.org/10.1128/aem.03492-14
[10] A. Mechaly, R. Alcalay, T. Noy-Porat, E. Epstein, Y. Gal, & O. Mazor, Novel phage display-derived anti-abrin antibodies confer post-exposure protection against abrin intoxication, Toxins, vol. 10, no. 2, p. 80, 2018. https://doi.org/10.3390/toxins10020080

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis.
Protein Families
Ribosome-inactivating protein family, Type 2 RIP subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*