Recombinant Absidia glauca Actin-1 (ACT1), partial

In Stock
Code CSB-EP320814AAD
Abbreviation Recombinant Absidia glauca ACT1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ACT1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ACT1Actin-1; Fragment
Species
Absidia glauca (Pin mould)
Source
E.coli
Expression Region
1-140aa
Target Protein Sequence
MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Absidia glauca Actin-1 (ACT1) is produced in E. coli and expressed as a partial length protein (1-140 amino acids). The protein carries an N-terminal 6xHis-tag and a C-terminal Myc-tag, which streamline purification and detection processes. SDS-PAGE analysis confirms that the protein achieves a purity level exceeding 85%, suggesting reliable performance in research applications.

Actin-1 from Absidia glauca appears to be a key component of the cytoskeleton, playing what seems to be a crucial role in cell structure and motility. Actin proteins are integral to various cellular processes. These include maintaining cell shape, enabling intracellular transport, and supporting cell division. Such functions make actin an important focus in studies related to cell biology and dynamics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Comparative Actin Structure-Function Studies

This recombinant Absidia glauca ACT1 fragment (1-140aa) may serve as a valuable tool for comparative studies examining actin evolution and structural diversity across different organisms. The N-terminal region of actin contains critical domains involved in nucleotide binding and polymerization. This makes the fragment suitable for investigating species-specific differences in actin biochemistry, though the extent of these differences remains to be fully characterized. Researchers can use this protein to compare binding affinities with various actin-binding proteins from different species. The dual His and Myc tags should simplify purification and detection in comparative binding assays.

2. Antifungal Drug Target Validation

The recombinant ACT1 fragment can be used in biochemical screens to identify compounds that specifically interact with fungal actin versus mammalian actin. This application leverages what appear to be evolutionary differences between fungal and animal actins to discover selective antifungal agents. The protein can be immobilized using the His-tag for high-throughput compound screening assays. Meanwhile, the Myc tag allows detection and quantification of protein-compound interactions through immunoassays.

3. Antibody Development and Characterization

This recombinant protein appears to serve as an excellent immunogen and screening antigen for developing antibodies specific to Absidia glauca or related fungal species. The dual tagging system allows for both purification via His-tag affinity chromatography and subsequent detection using anti-Myc antibodies in various immunoassays. Researchers can use this protein in ELISA-based screening to identify antibodies with desired specificity profiles. The fragment represents a defined antigenic region that may contain species-specific epitopes useful for diagnostic antibody development, though this will need experimental validation.

4. Protein-Protein Interaction Studies

The tagged ACT1 fragment can be used in pull-down assays to identify novel binding partners specific to fungal actin. The His-tag allows immobilization on nickel-based resins for affinity purification experiments using fungal cell lysates or purified protein libraries. The Myc tag provides an additional detection method for confirming protein interactions through co-immunoprecipitation studies. This approach might reveal unique protein interaction networks in pin mould that differ from well-characterized mammalian actin interactions.

5. Biochemical Characterization of Fungal Actin Properties

This recombinant fragment can be used to investigate the intrinsic biochemical properties of Absidia glauca actin, including nucleotide binding characteristics and stability under various conditions. The protein can be subjected to biophysical analyses such as circular dichroism spectroscopy to examine its folding properties and thermal stability. The dual tags should help with protein quantification and tracking during biochemical assays, allowing precise measurement of protein concentrations and recovery rates. These studies could provide fundamental insights into the molecular properties of fungal actins compared to their mammalian counterparts, though significant gaps in our understanding remain.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Subcellular Location
Cytoplasm, cytoskeleton.
Protein Families
Actin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*