Recombinant Absidia glauca Actin-1 (ACT1), partial

In Stock
Code CSB-EP320814AAD
Abbreviation Recombinant Absidia glauca ACT1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ACT1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ACT1Actin-1; Fragment
Species
Absidia glauca (Pin mould)
Source
E.coli
Expression Region
1-140aa
Target Protein Sequence
MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Absidia glauca Actin-1 (ACT1) is produced in E. coli and expressed as a partial-length protein (1-140 amino acids). The protein carries an N-terminal 6xHis-tag and a C-terminal Myc-tag, which streamline purification and detection processes. SDS-PAGE analysis confirms that the protein achieves a purity level exceeding 85%, suggesting reliable performance in research applications.

Actin-1 from Absidia glauca appears to be a key component of the cytoskeleton, playing what seems to be a crucial role in cell structure and motility. Actin proteins are integral to various cellular processes. These include maintaining cell shape, enabling intracellular transport, and supporting cell division. Such functions make actin an important focus in studies related to cell biology and dynamics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Absidia glauca Actin-1 (ACT1) is a cytoskeletal protein that requires precise folding, proper ATP-binding domain formation, specific tertiary structure, and polymerization capability for its functional activity. The E. coli expression system cannot provide the eukaryotic folding environment or post-translational modifications required for actin functionality. The partial fragment (1-140aa) represents only the N-terminal region and lacks critical C-terminal domains essential for actin polymerization, cofilin binding, and full functional activity. The dual N-terminal 6xHis-tag and C-terminal Myc-tag may sterically interfere with the protein's functional domains and structural integrity. The probability of correct folding with functional actin activity is extremely low.

1. Antibody Development and Characterization

This application has limited utility. While antibodies can be generated against this specific 1-140aa region, they will not recognize conformational epitopes of full-length actin and may not bind native actin in fungal cells. The immune response may predominantly target the foreign tags.

2. Biochemical Characterization of Fungal Actin Properties

Basic biophysical analysis can be performed, but will not reflect native actin properties. It provides only a basic characterization of this fragment. The 140aa fragment is too short to form functional actin domains, and the results will describe an artificial peptide rather than actin biochemistry. The tags will dominate the physical properties.

Final Recommendation & Action Plan

This 140aa actin fragment with dual tags is fundamentally unsuitable for meaningful actin research due to its partial nature (representing only ~37% of the full-length protein) and inability to form functional actin domains. The protein should not be used for functional studies as they would yield scientifically invalid results. For reliable actin research, use a full-length protein expressed in eukaryotic systems that supports proper folding, ATP-binding capability, and polymerization competence.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Subcellular Location
Cytoplasm, cytoskeleton.
Protein Families
Actin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*