Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-YP315474AYG1 |
| MSDS | |
| Size | Pls inquire |
| Source | Yeast |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP315474AYG1 |
| MSDS | |
| Size | Pls inquire |
| Source | E.coli |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP315474AYG1-B |
| MSDS | |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-BP315474AYG1 |
| MSDS | |
| Size | Pls inquire |
| Source | Baculovirus |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-MP315474AYG1 |
| MSDS | |
| Size | Pls inquire |
| Source | Mammalian cell |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
CSB-EP315474AYG Recombinant African swine fever Virus attachment protein p12 (Pret-110)
Could you please provide sequence, pricing, availability and tag information for all available sizes?
Have you received any customer feedback about the activity of this protein?
Thank you.
MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS
PRQQKKCSKAEECTCNNGSCSLKTS