Home
Protein
Recombinant Protein
Recombinant African swine fever virus Virus attachment protein p12 (Pret-110), partial

Recombinant African swine fever virus Virus attachment protein p12 (Pret-110), partial

Code	CSB-YP315474AYG1
MSDS	MSDS
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP315474AYG1
MSDS	MSDS
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP315474AYG1-B
MSDS	MSDS
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP315474AYG1
MSDS	MSDS
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP315474AYG1
MSDS	MSDS
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Pret-110

Uniprot No.

P0C9Y3

Alternative Names

Pret-110; Virus attachment protein p12; Protein p12

Species

African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

CSB-EP315474AYG Recombinant African swine fever Virus attachment protein p12 (Pret-110)
Could you please provide sequence, pricing, availability and tag information for all available sizes?
Have you received any customer feedback about the activity of this protein?
Thank you.

Thanks for your inquiry.
This is a transmembrane protein, we can only provide the full length protein expressed by the cell free expression system and we can provide the partial protein expressed by the regular four expression systems.
Full length protein:
Recombinant African swine fever virus Virus attachment protein p12 (Pret-110)
CSB-CF315474AYG
Expression Region: 1-61aa; Full length.
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 6xHis-SUMO-tagged)
Sequence:

MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS

Partial protein:
Recombinant African swine fever virus Virus attachment protein p12 (Pret-110),partial
CSB-YP315474AYG1 >> Yeast
CSB-EP315474AYG1 >> E.coli
CSB-BP315474AYG1 >> Baculovirus
CSB-MP315474AYG1 >> Mammalian cell
Expression Region: 37-61aa; Fragment at the C-terminal.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP, BP, MP: N-terminal 6xHis-tagged; EP: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.
Sequence:

PRQQKKCSKAEECTCNNGSCSLKTS

Regarding the activity. sorry, we haven't tested its activity and also haven't received the feedback about the activity from other customers.
Since we adpot affinity chromatography for purification, it's purified under very mild condition, in theory, it should be active, we recommend you to choose a small size to have a try.