Recombinant Anas platyrhynchos Lysozyme C-1

In Stock
Code CSB-EP360572BZD
Abbreviation Recombinant Anas platyrhynchos Lysozyme C-1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Lysozyme C-1; EC 3.2.1.17; 1,4-beta-N-acetylmuramidase C
Species
Anas platyrhynchos (Mallard) (Anas boschas)
Source
E.coli
Expression Region
19-147aa
Target Protein Sequence
KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCRGTDVSKWIRGCRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Anas platyrhynchos Lysozyme C-1 is produced using an E. coli expression system and includes a full-length mature protein spanning amino acids 19-147. The protein comes with an N-terminal 6xHis-SUMO tag to make purification and detection easier. SDS-PAGE analysis shows it reaches greater than 90% purity. This product is meant for research use only and appears to offer consistent quality for various experimental applications.

Lysozyme C-1 likely plays a crucial role in how Anas platyrhynchos defends itself by showing antibacterial activity. The protein works by breaking down the peptidoglycan layer of bacterial cell walls - something that's essential for keeping cell wall integrity intact. This makes it valuable for research focused on innate immunity and microbial interactions, potentially offering insights into how immune systems evolved across different species.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Anas platyrhynchos Lysozyme C-1 is a eukaryotic enzyme that requires precise disulfide bond formation and proper tertiary structure for its muramidase activity. The E. coli expression system cannot perform the necessary post-translational modifications (particularly proper disulfide bonding) that are critical for this enzyme's native conformation. The large N-terminal SUMO tag (∼15 kDa) may sterically interfere with the active site or proper folding. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional lysozyme activity. The probability of correct folding with enzymatic function is low.

1. Comparative Lysozyme Structure-Function Studies

This application is suitable for sequence-based comparisons and immunological cross-reactivity studies but not for functional comparative analyses. Functional comparative studies require properly folded, active enzymes that this misfolded variant cannot provide. A misfolded lysozyme will not provide meaningful data on enzymatic activity differences between species. Structural comparisons should be limited to sequence alignment and epitope mapping rather than functional enzymology.

2. Antibody Development and Immunological Research

This recombinant lysozyme serves as an excellent immunogen for generating antibodies against linear epitopes of duck lysozyme C-1. The full-length mature sequence ensures comprehensive epitope coverage. The SUMO tag facilitates purification and immunization procedures. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded enzyme.

3. Biochemical Characterization and Enzyme Assays

This is the essential first step to assess physical properties but not for functional enzyme assays. Techniques like circular dichroism can analyze secondary structure content, while thermal shift assays evaluate stability. However, enzymatic activity assays will likely yield negative results due to probable misfolding and are not recommended without activity validation.

Final Recommendation & Action Plan

This recombinant lysozyme is primarily suitable for antibody development and biophysical characterization but fundamentally unsuitable for functional studies due to E. coli's inability to produce properly folded eukaryotic enzyme. The immediate priority is Application 3 (Biochemical Characterization) to assess the protein's physical properties through CD spectroscopy and SEC analysis. Application 2 (Antibody Development) can proceed immediately. Application 1 should be limited to non-functional comparative studies. For functional lysozyme studies, alternative approaches using eukaryotic expression systems or native purification from duck eggs are essential.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
Subcellular Location
Secreted.
Protein Families
Glycosyl hydrolase 22 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*