Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

In Stock
Code CSB-BP522725DNK
Abbreviation Recombinant Apis mellifera MRJP1 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
MRJP1
Uniprot No.
Research Area
others
Alternative Names
MRJP1; Major royal jelly protein 1; MRJP-1; MRJP1; 56-kDa protein 4; p56kP-4; Apalbumin 1; Apisin subunit MRJP1; Bee-milk protein; Royalactin) [Cleaved into: Jellein-1; Jelleine-I); Jellein-2; Jelleine-II); Jellein-4; Jelleine-IV)]
Species
Apis mellifera (Honeybee)
Source
Baculovirus
Expression Region
20-432aa
Target Protein Sequence
NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1) is produced using a baculovirus expression system, which appears to ensure high-quality protein synthesis. The protein spans the full mature length from amino acids 20-432. It includes an N-terminal 10xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis confirms purity levels exceeding 85%, suggesting it's well-suited for various research applications.

Major royal jelly protein 1 (MRJP1) represents a key component of royal jelly - that remarkable secretion honeybees use to nourish their larvae and adult queens. The protein likely plays a crucial role in honeybee development and colony dynamics. Given MRJP1's biological functions and its apparent involvement in nutrition and development, it has become an important subject of study in entomology and related fields.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The utility of this recombinant MRJP1 for interaction studies is critically dependent on its folding state. The baculovirus system increases the probability of proper folding, but this is not guaranteed. If correctly folded, it could identify physiological binding partners, such as other royal jelly proteins or components in honeybee larval food. However, if misfolded, it may yield non-specific (false-positive) or non-physiological interactions, rendering the data unreliable and misleading without independent confirmation of its native structure.

2. Antibody Development and Immunoassay Applications

This protein can serve as an immunogen for antibody development. Even if misfolded, it will generate antibodies against linear epitopes, useful for techniques like Western blotting. However, for producing antibodies that recognize the native conformation of MRJP1 (e.g., for ELISA or immunoprecipitation under non-denaturing conditions), the protein must be correctly folded. Its usefulness for generating conformation-specific antibodies is contingent on its correct folding, which is unknown.

3. Biochemical Characterization and Stability Studies

This application is the primary and essential first step to determine the protein's folding state and biophysical properties. Techniques like Size Exclusion Chromatography (SEC) and Circular Dichroism (CD) can assess its oligomeric state, homogeneity, secondary structure, and thermal stability, providing critical data on whether the protein is natively folded.

4. Comparative Protein Analysis and Evolutionary Studies

This protein can be used for sequence-based comparisons (e.g., as a standard in Western blotting). However, for meaningful comparative structural or functional studies (e.g., comparing stability or ligand binding across species), all proteins being compared must be in their native, correctly folded states. Any functional or structural comparative analysis would be invalid without confirmation of correct folding.

Final Recommendation & Action Plan

The unknown folding state is the critical limiting factor. The only scientifically valid course of action is to prioritize Application 3 (Biochemical Characterization) above all others to determine if the protein is correctly folded. SEC and CD analyses must be performed first. If the protein is folded correctly and is monodisperse, it becomes suitable for Applications 1, 2 (for conformation-specific antibodies), and meaningful comparative studies in Application 4. If it is misfolded or aggregated, its use should be restricted to Application 2 for generating linear epitope antibodies and as a control reagent. Investing in functional studies (Application 1) before this validation is high-risk.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces the differentiation of honeybee larvae into queens through an Egfr-mediated signaling pathway. Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing the 20-hydroxyecdysone protein (20E). Most abundant protein found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen.; Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation.; Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation.; Lacks antibacterial and antifungal activity. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.
Gene References into Functions
  1. Mass spectrometry data demonstrate that the native complexes of royal jelly predominantly exist in a four MRJP1 and four apisimin molecules stoichiometry. PMID: 28252287
  2. These results suggest that MRJP1 exists mainly as apisin in royal jelly. PMID: 23748766
Subcellular Location
Secreted.
Protein Families
Major royal jelly protein family
Tissue Specificity
Found in the hypopharyngeal glands of the worker honeybee.
Database Links

KEGG: ame:406090

UniGene: Ame.208

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*