Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1)

In Stock
Code CSB-YP522725DNK
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MRJP1
Uniprot No.
Research Area
Others
Alternative Names
MRJP1; Major royal jelly protein 1; MRJP-1; MRJP1; 56-kDa protein 4; p56kP-4; Apalbumin 1; Apisin subunit MRJP1; Bee-milk protein; Royalactin) [Cleaved into: Jellein-1; Jelleine-I); Jellein-2; Jelleine-II); Jellein-4; Jelleine-IV)]
Species
Apis mellifera (Honeybee)
Source
Yeast
Expression Region
20-432aa
Target Protein Sequence
NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
48.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The DNA fragment encoding the 20-432aa of the Apis mellifera MRJP1 protein was fused with N-terminal 6xHis tag gene and then was inserted into the expression vector, which was subsequently transfected into the yeast cells for expression. The resulting product was further purified to obtain the recombinant Apis mellifera MRJP1 protein. The purity of this recombinant MRJP1 protein is greater than 90% assessed by Bandscan software analysis combined with SDS-PAGE. This MRJP1 protein showed a band on the gel with a molecular weight of approximately 48 kDa.

MRJP1 belongs to the major royal jelly protein family, secreted by nurse bees into the royal jelly. MRJP1 provides pivotal amount of nutrients for the queen larvae as well as worker bees. Therefore, MRJP1 as major bee bread, it plays important roles in bee's life. MRJP1 usually is presented in the hypopharyngeal gland. Besides, it has been found in the cytoplasm of brain cells. Some studies identified that MRJP1 could influence the brain function, which is probably related to the development of learning ability of brain. Owing to the special biological properties, the functions of MRJP1 has been investigated widely. Researchers further observed that MRJP1 is consider as a key modulator in the longevity, anti-oxidant, anti-tumor, and immune aspects.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces the differentiation of honeybee larvae into queens through an Egfr-mediated signaling pathway. Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing the 20-hydroxyecdysone protein (20E). Most abundant protein found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen.; Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation.; Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans. Lack cytolytic activity and does not induce rat peritoneal mast cell degranulation.; Lacks antibacterial and antifungal activity. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.
Gene References into Functions
  1. Mass spectrometry data demonstrate that the native complexes of royal jelly predominantly exist in a four MRJP1 and four apisimin molecules stoichiometry. PMID: 28252287
  2. These results suggest that MRJP1 exists mainly as apisin in royal jelly. PMID: 23748766
Subcellular Location
Secreted.
Protein Families
Major royal jelly protein family
Tissue Specificity
Found in the hypopharyngeal glands of the worker honeybee.
Database Links

KEGG: ame:406090

UniGene: Ame.208

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*