Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
MRJP1; Major royal jelly protein 1; MRJP-1; MRJP1; 56-kDa protein 4; p56kP-4; Apalbumin 1; Apisin subunit MRJP1; Bee-milk protein; Royalactin) [Cleaved into: Jellein-1; Jelleine-I); Jellein-2; Jelleine-II); Jellein-4; Jelleine-IV)]
Species
Apis mellifera (Honeybee)
Expression Region
20-432aa
Target Protein Sequence
NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The DNA fragment encoding the 20-432aa of the Apis mellifera MRJP1 protein was fused with N-terminal 6xHis tag gene and then was inserted into the expression vector, which was subsequently transfected into the yeast cells for expression. The resulting product was further purified to obtain the recombinant Apis mellifera MRJP1 protein. The purity of this recombinant MRJP1 protein is greater than 90% assessed by Bandscan software analysis combined with SDS-PAGE. This MRJP1 protein showed a band on the gel with a molecular weight of approximately 48 kDa.
MRJP1 belongs to the major royal jelly protein family, secreted by nurse bees into the royal jelly. MRJP1 provides pivotal amount of nutrients for the queen larvae as well as worker bees. Therefore, MRJP1 as major bee bread, it plays important roles in bee's life. MRJP1 usually is presented in the hypopharyngeal gland. Besides, it has been found in the cytoplasm of brain cells. Some studies identified that MRJP1 could influence the brain function, which is probably related to the development of learning ability of brain. Owing to the special biological properties, the functions of MRJP1 has been investigated widely. Researchers further observed that MRJP1 is consider as a key modulator in the longevity, anti-oxidant, anti-tumor, and immune aspects.