Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
RBP47A; At1g49600; F14J22.16; Polyadenylate-binding protein RBP47A; Poly(A)-binding protein RBP47A; RNA-binding protein 47A; AtRBP47A
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-445aa
Target Protein Sequence
MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSPNKQWRSDSGNQWNGGYSRGQGYNNGYANQDSNMYATAAAAVPGAS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Expressing the recombinant Arabidopsis thaliana (Mouse-ear cress) RBP47A protein generally involves constructing a plasmid encoding the Arabidopsis thaliana (Mouse-ear cress) RBP47A protein (1-445aa). This plasmid is introduced into e.coli cells, followed by the selection and culturing of positive e.coli cells, induction of protein expression, and subsequent cell lysis. The protein is fused with a N-terminal 10xHis tag and C-terminal Myc tag. The recombinant Arabidopsis thaliana (Mouse-ear cress) RBP47A protein is purified through affinity purification, and SDS-PAGE analysis is conducted to confirm the presence of the protein and determine its purity. This protein exhibits a purity exceeding 90%.
