Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

SIZ1

Uniprot No.

Q680Q4

Research Area

others

Alternative Names

E3 SUMO-protein transferase SIZ1

Species

Arabidopsis thaliana (Mouse-ear cress)

Source

E.coli

Expression Region

1-171aa

Target Protein Sequence

MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTVAKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRAD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.2 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Arabidopsis thaliana (Mouse-ear cress) SIZ1 protein is made by following sequential steps: inserting a DNA fragment encoding the Arabidopsis thaliana (Mouse-ear cress) SIZ1 protein (1-171aa) into a plasmid vector, transferring this vector into e.coli cells, selecting the positive cells, culturing positive cells, inducing the protein expression, and collecting the SIZ1 protein. The protein features a N-terminal 6xHis tag fusion. The recombinant SIZ1 protein is subjected to affinity purification and SDS-PAGE analysis. Its purity is over 85%.

Target Background

Function

E3 SUMO protein ligase involved in regulation processes. Mediates SUMO/ attachment to PHR1, a MYB transcriptional activator controlling the phosphate deficiency responses. Functions as an upstream negative regulator of salicylic acid (SA) accumulation and subsequent SA-mediated systemic acquired resistance (SAR) signaling. Probably not involved in jasmonic acid (JA)-mediated defense response. Participates in abiotic stress-induced sumoylation. Controls heat shock-induced SUMO1 and SUMO2 conjugation and facilitates basal thermotolerance. Involved in freezing tolerance by mediating sumoylation of ICE1, a transcription activator of the cold signaling regulator CBF3/DREB1A. Acts as positive regulator of drought stress tolerance. Acts as floral repressor that promotes FLC expression by repressing FLD activity through sumoylation. Acts as negative regulator of abscisic acid (ABA) signaling through ABI5 sumoylation. Mediates sumoylation of SCE1, GTE3 and GTE5. Functions as negative regulator of SnRK1 signaling through sumoylation of several components of the SnRK1 complex.

Gene References into Functions

Arabidopsis thaliana SIZ1 controls nuclear localization of Nitrate Reductases proteins, and ammonium negatively regulates their levels. PMID: 29662028
SIZ1 suppresses an SNC1-dependent resistance response at both normal and high temperatures. At the same time, SIZ1 amplifies the dark and high temperature growth response, likely via COP1 and upstream of gene regulation by PIF4 and BRZ1. PMID: 29357355
The SnRK1 complex is SUMOylated on multiple subunits and identify SIZ1 as the E3 Small Ubiquitin-like Modifier (SUMO) ligase responsible for this modification. PMID: 26662259
regulates seed dormancy and germination PMID: 27130140
SUMO-conjugated proteins accumulate in response to high doses of sugar in a SIZ1-dependent manner. PMID: 26468507
The methylation level of the Arabidopsis genome, including transposons, was significantly lower in the siz1-2 mutant than in wild-type plants. CMT3 was sumoylated by the E3 ligase activity of AtSIZ1 through a direct interaction. PMID: 26398805
negatively affects stomatal closure and drought tolerance through accumulation of salicylic acid PMID: 22963672
This study establishes that the diverse properties characteristic of SIZ1 are associated with specific domains and that they can be separated. PMID: 20404572
The AtSIZ1 mutation is correlated with an overall decrease in alternative respiration and with a low carbohydrate content to maintain the carbon to nitrogen ratio in siz1-2 mutants. PMID: 22732219
SIZ1 sustains the stability and normal function of the mature female gametophyte which is necessary for pollen tube guidance. PMID: 22253727
The expression and enzymatic activity of Cu/ZnSOD1 (CSD1) in shoots of the siz1 mutant under excess Cu, was examined. PMID: 21897129
These data suggest that SIZ1-mediated sumoylation is involved specifically in copper homeostasis and tolerance in planta. PMID: 21632972
AtSIZ1 positively controls nitrogen assimilation by promoting sumoylation of nitrate reductases in Arabidopsis. PMID: 21772271
SIZ1 facilitates the auxin-regulated root architecture remodeling that occurs in response to Pi deficiency. PMID: 21156857
The salicylic acid-accumulating mutant siz1 exhibits sensitivity to chilling and freezing conditions. PMID: 19959255
These results indicate that SIZ1 regulates cell growth and plant development with regulation of salicylic acid accumulation. PMID: 20007967
The various domains of SIZ1 make unique contributions to the plant's ability to cope with its environment. PMID: 19837819
SIZ1 and sumoylation facilitate basal thermotolerance through processes that are salicylic acid independent. PMID: 17041025
SIZ1 is required for salicylic acid and PAD4-mediated R gene signalling, which in turn confers innate immunity in Arabidopsis.[SIZ1] PMID: 17163880
SIZ1 is a SUMO E3 ligase that facilitates conjugation of SUMO to protein substrates. PMID: 17416732
SIZ1 regulates Arabidopsis growth and that this SUMO E3 ligase plays a role in drought stress response likely through the regulation of gene expression. PMID: 17905899
Results suggest that SIZ1 is a floral repressor that not only represses the SA-dependent pathway, but also promotes FLC expression by repressing FLD activity through sumoylation, which is required for full FLC expression in a FRIGIDA background. PMID: 18069938

Hide All

Subcellular Location

Nucleus speckle.

Protein Families

PIAS family

Tissue Specificity

Ubiquitous.

Database Links

KEGG: ath:AT5G60410

STRING: 3702.AT5G60410.2

UniGene: At.43746

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP721197DOA
Abbreviation	Recombinant Mouse-ear cress SIZ1 protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Arabidopsis thaliana E3 SUMO-protein ligase SIZ1 (SIZ1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage