Recombinant Arabidopsis thaliana E3 SUMO-protein ligase SIZ1 (SIZ1), partial

In Stock
Code CSB-EP721197DOA
Abbreviation Recombinant Mouse-ear cress SIZ1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SIZ1
Uniprot No.
Research Area
others
Alternative Names
E3 SUMO-protein transferase SIZ1
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
E.coli
Expression Region
1-171aa
Target Protein Sequence
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTVAKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRAD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Arabidopsis thaliana (Mouse-ear cress) SIZ1 protein is made by following sequential steps: inserting a DNA fragment encoding the Arabidopsis thaliana (Mouse-ear cress) SIZ1 protein (1-171aa) into a plasmid vector, transferring this vector into e.coli cells, selecting the positive cells, culturing positive cells, inducing the protein expression, and collecting the SIZ1 protein. The protein features a N-terminal 6xHis tag fusion. The recombinant SIZ1 protein is subjected to affinity purification and SDS-PAGE analysis. Its purity is over 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 SUMO protein ligase involved in regulation processes. Mediates SUMO/ attachment to PHR1, a MYB transcriptional activator controlling the phosphate deficiency responses. Functions as an upstream negative regulator of salicylic acid (SA) accumulation and subsequent SA-mediated systemic acquired resistance (SAR) signaling. Probably not involved in jasmonic acid (JA)-mediated defense response. Participates in abiotic stress-induced sumoylation. Controls heat shock-induced SUMO1 and SUMO2 conjugation and facilitates basal thermotolerance. Involved in freezing tolerance by mediating sumoylation of ICE1, a transcription activator of the cold signaling regulator CBF3/DREB1A. Acts as positive regulator of drought stress tolerance. Acts as floral repressor that promotes FLC expression by repressing FLD activity through sumoylation. Acts as negative regulator of abscisic acid (ABA) signaling through ABI5 sumoylation. Mediates sumoylation of SCE1, GTE3 and GTE5. Functions as negative regulator of SnRK1 signaling through sumoylation of several components of the SnRK1 complex.
Gene References into Functions
  1. Arabidopsis thaliana SIZ1 controls nuclear localization of Nitrate Reductases proteins, and ammonium negatively regulates their levels. PMID: 29662028
  2. SIZ1 suppresses an SNC1-dependent resistance response at both normal and high temperatures. At the same time, SIZ1 amplifies the dark and high temperature growth response, likely via COP1 and upstream of gene regulation by PIF4 and BRZ1. PMID: 29357355
  3. The SnRK1 complex is SUMOylated on multiple subunits and identify SIZ1 as the E3 Small Ubiquitin-like Modifier (SUMO) ligase responsible for this modification. PMID: 26662259
  4. regulates seed dormancy and germination PMID: 27130140
  5. SUMO-conjugated proteins accumulate in response to high doses of sugar in a SIZ1-dependent manner. PMID: 26468507
  6. The methylation level of the Arabidopsis genome, including transposons, was significantly lower in the siz1-2 mutant than in wild-type plants. CMT3 was sumoylated by the E3 ligase activity of AtSIZ1 through a direct interaction. PMID: 26398805
  7. negatively affects stomatal closure and drought tolerance through accumulation of salicylic acid PMID: 22963672
  8. This study establishes that the diverse properties characteristic of SIZ1 are associated with specific domains and that they can be separated. PMID: 20404572
  9. The AtSIZ1 mutation is correlated with an overall decrease in alternative respiration and with a low carbohydrate content to maintain the carbon to nitrogen ratio in siz1-2 mutants. PMID: 22732219
  10. SIZ1 sustains the stability and normal function of the mature female gametophyte which is necessary for pollen tube guidance. PMID: 22253727
  11. The expression and enzymatic activity of Cu/ZnSOD1 (CSD1) in shoots of the siz1 mutant under excess Cu, was examined. PMID: 21897129
  12. These data suggest that SIZ1-mediated sumoylation is involved specifically in copper homeostasis and tolerance in planta. PMID: 21632972
  13. AtSIZ1 positively controls nitrogen assimilation by promoting sumoylation of nitrate reductases in Arabidopsis. PMID: 21772271
  14. SIZ1 facilitates the auxin-regulated root architecture remodeling that occurs in response to Pi deficiency. PMID: 21156857
  15. The salicylic acid-accumulating mutant siz1 exhibits sensitivity to chilling and freezing conditions. PMID: 19959255
  16. These results indicate that SIZ1 regulates cell growth and plant development with regulation of salicylic acid accumulation. PMID: 20007967
  17. The various domains of SIZ1 make unique contributions to the plant's ability to cope with its environment. PMID: 19837819
  18. SIZ1 and sumoylation facilitate basal thermotolerance through processes that are salicylic acid independent. PMID: 17041025
  19. SIZ1 is required for salicylic acid and PAD4-mediated R gene signalling, which in turn confers innate immunity in Arabidopsis.[SIZ1] PMID: 17163880
  20. SIZ1 is a SUMO E3 ligase that facilitates conjugation of SUMO to protein substrates. PMID: 17416732
  21. SIZ1 regulates Arabidopsis growth and that this SUMO E3 ligase plays a role in drought stress response likely through the regulation of gene expression. PMID: 17905899
  22. Results suggest that SIZ1 is a floral repressor that not only represses the SA-dependent pathway, but also promotes FLC expression by repressing FLD activity through sumoylation, which is required for full FLC expression in a FRIGIDA background. PMID: 18069938

Show More

Hide All

Subcellular Location
Nucleus speckle.
Protein Families
PIAS family
Tissue Specificity
Ubiquitous.
Database Links

KEGG: ath:AT5G60410

STRING: 3702.AT5G60410.2

UniGene: At.43746

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*