Recombinant Arabidopsis thaliana GRF1-interacting factor 1 (GIF1)

In Stock Promotion
Code CSB-EP781430DOA
Abbreviation Recombinant Mouse-ear cress GIF1 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,780+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GIF1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
(AtGIF1)(Protein ANGUSTIFOLIA 3)(Transcription coactivator GIF1)
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
E.coli
Expression Region
1-210aa
Target Protein Sequence
MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Arabidopsis thaliana GRF1-interacting factor 1 (GIF1) is produced in an E. coli expression system, spanning the complete protein sequence from amino acids 1 to 210. The protein carries an N-terminal 6xHis-KSI tag, which appears to simplify purification and detection processes. SDS-PAGE analysis indicates purity levels above 85%, suggesting this recombinant GIF1 may be appropriate for various research applications. This product is intended for research use only.

GIF1, or GRF1-interacting factor 1, is a protein from Arabidopsis thaliana that seems to play an important role in regulating plant growth and development. It likely interacts with growth-regulating factors, potentially influencing pathways that are crucial for morphological adaptations and responses to environmental stimuli. Studying GIF1's interactions and functions might provide valuable insights into plant biology and could aid researchers exploring plant developmental processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The E. coli system lacks eukaryotic chaperones and post-translational modification machinery, increasing the likelihood of misfolding or inclusion body formation. Furthermore, the N-terminal 6xHis-KSI tag (where KSI is ketosteroid isomerase, a large fusion partner) could sterically interfere with the correct folding of the N-terminal region of GIF1, which is critical for its interaction with GRF proteins. Therefore, this recombinant GIF1 protein is highly likely to be incorrectly folded and lack bioactivity due to the E. coli expression system and the potential interference of the N-terminal 6xHis-KSI tag. Experimental validation is essential before any functional application.

1. Protein-Protein Interaction Studies with GRF Transcription Factors

The recombinant GIF1 protein could be used to study interactions with GRF transcription factors only if its correct folding is experimentally verified. The His-tag allows technical immobilization for pull-down assays. However, if the protein is misfolded, its interaction interfaces may be altered, leading to false-negative results (failure to bind GRFs) or non-physiological bindings. The N-terminal tag is particularly concerning, as the N-terminal region of GIF1 is directly involved in GRF binding. Any interaction data must be validated with native proteins from plant tissues.

2. Antibody Development and Validation

This recombinant GIF1 protein can serve as an immunogen for generating antibodies targeting linear epitopes, as antibody production often relies on amino acid sequences rather than native conformation. The full-length sequence provides comprehensive epitope coverage. However, if antibodies are intended to recognize the native, correctly folded GIF1 in its physiological context (e.g., for immunofluorescence or co-immunoprecipitation), misfolding of the recombinant antigen may result in antibodies that fail to bind the natural protein. The high purity reduces risks from contaminants, but the tag might induce tag-specific antibodies.

3. Biochemical Characterization and Structural Studies

The protein is unsuitable for meaningful biochemical or structural analysis without prior folding validation. Techniques like circular dichroism or dynamic light scattering could be applied, but data from a misfolded protein would not reflect the native structure of GIF1. The large KSI fusion tag may dominate biophysical properties and obscure GIF1-specific characteristics. For structural studies (e.g., X-ray crystallography), a correctly folded, homogeneous sample is essential; a misfolded protein would yield uninterpretable results.

4. His-Tag Affinity-Based Functional Assays

The His-tag enables technical applications like immobilization on nickel surfaces for affinity purification or screening. However, functional assays (e.g., screening for modulators) are entirely dependent on bioactivity. If GIF1 is misfolded and inactive, assays designed to study its function would produce invalid results. The tag facilitates protein handling, but cannot compensate for the lack of native structure. Any functional findings require confirmation with bioactive GIF1.

Final Recommendation & Action Plan

Given the high probability of misfolding, the immediate priority is to experimentally validate the protein's conformation and bioactivity before any application. Start with biophysical characterization using size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state and monodispersity, and circular dichroism spectroscopy to analyze secondary structure. Then, perform a functional protein-protein interaction assay using a known GRF protein as a positive control to test binding capability . If the protein shows evidence of correct folding and GRF-binding activity, it can be cautiously used for interaction studies or as an immunogen for linear epitope antibodies (with disclosure of limitations). If validation fails, the protein should only be used for technical practices like tag-based purification training or as a negative control in folding studies, and not for biological investigations. Always explicitly state the lack of functional validation in any research communications.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. Appears to function synergistically with GRF1 as a transcriptional coactivator. Acts together with GRF5 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. Plays a role in adaxial/abaxial patterning and growth in leaf morphogenesis. GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner. Together with GATA18/HAN, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression.
Gene References into Functions
  1. GRF-GIF duo regulates the meristematic and pluripotent competence of carpel margin meristems. PMID: 29114079
  2. Rice MKB3 and Arabidopsis AN3 have conserved functions and effects on leaf development PMID: 29567670
  3. AN3 and YDA mutations both disrupt normal sucrose and glucose contents and cause altered seed size in an3 or yda mutants. PMID: 28489361
  4. Nuclear localization of AN3 during initial leaf growth results in differential expression of important transcriptional regulators, including GROWTH REGULATING FACTORs (GRFs). PMID: 24443518
  5. ANGUSTIFOLIA3 (AN3) moves into Arabidopsis epidermal cells after being synthesized within mesophyll cells and helps control epidermal cell proliferation. Interference with AN3 movement results in abnormal leaf size and shape. PMID: 23602479
  6. AN3 and AtGRF5 act together and are required for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation. [AN3] PMID: 15960617
  7. Data found that an3-dependent compensation is a non-cell-autonomous process, and that an3 cells seem to generate and transmit an intercellular signal that enhances postmitotic cell expansion. PMID: 21068059
  8. Overexpression of miR396 in a mutant lacking GRF-INTERACTING FACTOR 1 severely compromises the shoot meristem. PMID: 20023165
  9. The GIF gene family plays important roles in the control of cell proliferation via cell cycle regulation and in other developmental properties that are associated with shoot apical meristem function. PMID: 19648231

Show More

Hide All

Protein Families
SS18 family
Tissue Specificity
Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips and flower buds. Also expressed in mature flowers. Not expressed in the shoot apical meristem (SAM). Highly accumulated in the proximal part of leaf
Database Links

KEGG: ath:AT5G28640

STRING: 3702.AT5G28640.1

UniGene: At.22564

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*