Recombinant Arabidopsis thaliana GRF1-interacting factor 1 (GIF1)

In Stock
Code CSB-EP781430DOA
Abbreviation Recombinant Mouse-ear cress GIF1 protein
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GIF1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
(AtGIF1)(Protein ANGUSTIFOLIA 3)(Transcription coactivator GIF1)
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
E.coli
Expression Region
1-210aa
Target Protein Sequence
MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Arabidopsis thaliana GRF1-interacting factor 1 (GIF1) is produced in an E. coli expression system, spanning the complete protein sequence from amino acids 1 to 210. The protein carries an N-terminal 6xHis-KSI tag, which appears to simplify purification and detection processes. SDS-PAGE analysis indicates purity levels above 85%, suggesting this recombinant GIF1 may be appropriate for various research applications. This product is intended for research use only.

GIF1, or GRF1-interacting factor 1, is a protein from Arabidopsis thaliana that seems to play an important role in regulating plant growth and development. It likely interacts with growth-regulating factors, potentially influencing pathways that are crucial for morphological adaptations and responses to environmental stimuli. Studying GIF1's interactions and functions might provide valuable insights into plant biology and could aid researchers exploring plant developmental processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies with GRF Transcription Factors

This recombinant GIF1 protein can be used to investigate its interactions with Growth-Regulating Factor (GRF) transcription factors in Arabidopsis thaliana through in vitro binding assays. The N-terminal 6xHis-KSI tag allows for purification and immobilization in pull-down experiments designed to identify and characterize GRF binding partners. Co-immunoprecipitation studies using the tagged GIF1 may help researchers map the specific domains involved in GRF-GIF1 complex formation. These interaction studies appear fundamental for understanding the molecular mechanisms of plant growth regulation and transcriptional control networks.

2. Antibody Development and Validation

The purified recombinant GIF1 protein serves as what appears to be an ideal antigen for generating specific antibodies against Arabidopsis GIF1. The high purity level (>85%) and full-length nature of the protein likely ensure comprehensive epitope coverage for both polyclonal and monoclonal antibody production. These antibodies can subsequently be validated using the same recombinant protein in Western blot, ELISA, and immunofluorescence applications. The His-tagged protein also seems to make possible the development of sandwich ELISA assays for quantitative detection of GIF1 in plant extracts.

3. Biochemical Characterization and Structural Studies

This recombinant protein makes possible detailed biochemical analysis of GIF1 properties including thermal stability, pH sensitivity, and cofactor requirements. Researchers can apply the purified protein to analytical techniques such as dynamic light scattering, circular dichroism spectroscopy, and mass spectrometry to characterize its biophysical properties. Size exclusion chromatography experiments may help determine the oligomerization state of GIF1 in solution. These studies could provide foundational data for understanding GIF1 structure-function relationships in plant biology research.

4. His-Tag Affinity-Based Functional Assays

The N-terminal 6xHis-KSI tag makes possible the development of nickel-affinity based assays to study GIF1 function and regulation. The tagged protein can be immobilized on nickel-coated surfaces for screening potential small molecule modulators or identifying novel protein partners through affinity chromatography. Pull-down assays using the His-tagged GIF1 might isolate associated protein complexes from Arabidopsis cell lysates for mass spectrometry analysis. These tag-assisted approaches appear to support high-throughput screening and discovery of GIF1-interacting molecules in plant research applications.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. Appears to function synergistically with GRF1 as a transcriptional coactivator. Acts together with GRF5 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. Plays a role in adaxial/abaxial patterning and growth in leaf morphogenesis. GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner. Together with GATA18/HAN, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression.
Gene References into Functions
  1. GRF-GIF duo regulates the meristematic and pluripotent competence of carpel margin meristems. PMID: 29114079
  2. Rice MKB3 and Arabidopsis AN3 have conserved functions and effects on leaf development PMID: 29567670
  3. AN3 and YDA mutations both disrupt normal sucrose and glucose contents and cause altered seed size in an3 or yda mutants. PMID: 28489361
  4. Nuclear localization of AN3 during initial leaf growth results in differential expression of important transcriptional regulators, including GROWTH REGULATING FACTORs (GRFs). PMID: 24443518
  5. ANGUSTIFOLIA3 (AN3) moves into Arabidopsis epidermal cells after being synthesized within mesophyll cells and helps control epidermal cell proliferation. Interference with AN3 movement results in abnormal leaf size and shape. PMID: 23602479
  6. AN3 and AtGRF5 act together and are required for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation. [AN3] PMID: 15960617
  7. Data found that an3-dependent compensation is a non-cell-autonomous process, and that an3 cells seem to generate and transmit an intercellular signal that enhances postmitotic cell expansion. PMID: 21068059
  8. Overexpression of miR396 in a mutant lacking GRF-INTERACTING FACTOR 1 severely compromises the shoot meristem. PMID: 20023165
  9. The GIF gene family plays important roles in the control of cell proliferation via cell cycle regulation and in other developmental properties that are associated with shoot apical meristem function. PMID: 19648231

Show More

Hide All

Protein Families
SS18 family
Tissue Specificity
Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips and flower buds. Also expressed in mature flowers. Not expressed in the shoot apical meristem (SAM). Highly accumulated in the proximal part of leaf
Database Links

KEGG: ath:AT5G28640

STRING: 3702.AT5G28640.1

UniGene: At.22564

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*