Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21)

In Stock
Code CSB-EP327028DOA
Abbreviation Recombinant Mouse-ear cress HSP21 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
HSP21
Uniprot No.
Research Area
Immunology
Alternative Names
25.3 kDa heat shock protein, chloroplastic
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
E.coli
Expression Region
44-227aa
Target Protein Sequence
AQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Arabidopsis thaliana Heat shock protein 21 (HSP21) is produced in an E. coli expression system, spanning the full length of the mature protein from amino acids 44 to 227. The protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which streamline purification and detection processes. SDS-PAGE analysis confirms purity greater than 90%, suggesting this preparation should deliver reliable results for research applications.

Heat shock protein 21 (HSP21) in Arabidopsis thaliana appears to be a chloroplast-localized protein that may play a crucial role in how plants respond to heat stress. This protein belongs to the small heat shock protein family, which works to stabilize and refold denatured proteins, helping maintain cellular balance. Research into HSP21 could be vital for understanding plant stress responses and how they adapt to challenging conditions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Although the protein covers the full-length mature sequence (44-227aa), several factors raise concerns: 1) The dual tagging system (N-terminal 10xHis and C-terminal Myc) may significantly interfere with proper folding - the C-terminal Myc tag is particularly problematic as it could disrupt the conserved C-terminal region essential for oligomerization and client protein binding in small heat shock proteins; 2) The E. coli expression system lacks chloroplast-specific factors (redox environment, chaperones) necessary for proper folding of plant chloroplastic proteins; 3) HSP21 requires correct oligomerization and disulfide bond formation for function, which may be compromised by the tags and prokaryotic expression. The >90% purity indicates low contaminants, but doesn't guarantee proper quaternary structure formation. Without validation through circular dichroism, thermal stability assays, and chaperone activity tests, the protein's functional status remains uncertain.

1. In Vitro Protein-Protein Interaction Studies

This dual-tagged HSP21 can be used for interaction studies only if proper folding and oligomerization are verified. The tags may cause steric hindrance or non-specific binding - the C-terminal Myc tag could block natural interaction interfaces. Before pull-down or co-IP experiments, validate the protein's ability to form functional oligomers and interact with known client proteins. Include tag-only controls and consider using tag-free protein for biologically relevant results.

2. Antibody Development and Validation

The recombinant protein can generate antibodies, but the dual tags may dominate the immune response, resulting in antibodies that primarily recognize tags rather than HSP21-specific epitopes. If misfolded, antibodies may not recognize native chloroplastic HSP21. For reliable antibodies, validate using tag-free protein and confirm recognition of endogenous HSP21 in plant tissues. The Myc tag provides a detection control but doesn't ensure utility for native protein studies.

3. Biochemical Characterization of Heat Shock Response

This protein is suitable for biophysical characterization only if the tags are removed and proper oligomerization is confirmed. The dual tags may alter thermal stability and oligomeric state measurements. For circular dichroism or dynamic light scattering, use a tag-free protein to obtain meaningful data. The E. coli expression system may not replicate chloroplast-specific modifications affecting stability.

4. Comparative Plant Stress Biology Research

The recombinant HSP21 can serve as a reference for comparative studies only if properly folded. The tags may introduce structural artifacts that complicate cross-species comparisons. Validate that the protein's structural and functional properties match those of native HSP21 before comparative analyses. Tag removal is recommended for evolutionary studies.

5. Chloroplast Proteomics and Pathway Analysis

This protein can work as a positive control in proteomics if the tags don't interfere with detection. However, the Myc tag may cause dominance in mass spectrometry analysis. For accurate quantification, use tag-free protein or validate that tag presence doesn't affect detection sensitivity and specificity in complex mixtures.

Final Recommendation & Action Plan

To ensure reliable results, first validate the protein's folding and functionality: remove both tags via proteolytic cleavage (if cleavage sites are available) and purify the tag-free protein; characterize secondary structure by circular dichroism (expecting high β-sheet content typical of sHSPs); test oligomerization state via size-exclusion chromatography with multi-angle light scattering; and validate chaperone activity through thermal aggregation protection assays using client proteins like citrate synthase. For applications requiring native-like behavior, always use tag-free protein. If tags must remain, include rigorous controls: tag-only proteins for interaction studies, stress-conditioned plant extracts for antibody validation, and known HSP21 standards for comparative analyses. The E. coli expression system is cost-effective but may require additional refolding steps to achieve functional protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chaperone protein required for seedling and chloroplast development under heat stress, probably by maintaining plastid-encoded RNA polymerase (PEP)-dependent transcription.
Gene References into Functions
  1. plastid-localized metalloprotease FtsH6 regulates HSP21 abundance. Lack of a functional FtsH6 protein promotes HSP21 accumulation during the later stages of thermomemory and increases thermomemory capacity. PMID: 27561243
  2. Findings reveal an auto-adaptation loop pathway that plant cells optimize particular needs of chloroplasts in stabilizing photosynthetic complexes by relaying the GUN5-dependent plastid signal(s) to activate the heat-responsive expression of HSP21 in the nucleus during adaptation to heat stress in plants. PMID: 27943531
  3. Studied Hsp21 association with thylakoid membranes in heat stress resistance of Arabidopsis thaliana. PMID: 28608391
  4. analysis of the structure of dodecameric heat-shock protein Hsp21 PMID: 28325834
  5. Present a structure model of Arabidopsis thaliana Hsp21, obtained by homology modeling, single-particle electron microscopy, and lysine-specific chemical crosslinking. PMID: 21280121
  6. evolution of a pseudogene: diversity and divergence of HSP21 PMID: 18356953

Show More

Hide All

Subcellular Location
Plastid, chloroplast stroma, chloroplast nucleoid.
Protein Families
Small heat shock protein (HSP20) family
Tissue Specificity
Confined to pollen grains of budding flowers.
Database Links

KEGG: ath:AT4G27670

STRING: 3702.AT4G27670.1

UniGene: At.5368

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*