Recombinant Arabidopsis thaliana Putative defensin-like protein 70(LCR83)

Code CSB-YP306814DOA
Product Type Recombinant Protein
Size US$2959
Uniprot No. P82792
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83
Species Arabidopsis thaliana (Mouse-ear cress)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT
Research Area Others
Source Yeast
Gene Names LCR83
Protein Names Recommended name: Putative defensin-like protein 70 Alternative name(s): Putative low-molecular-weight cysteine-rich protein 83 Short name= Protein LCR83
Expression Region 28-82aa
Tag Info N-terminal GST-tagged
Mol. Weight 32.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Protein Families DEFL family
Database Links

KEGG: ath:AT5G54225

STRING: 3702.AT5G54225.1

Related Products

LCR83 Antibodies

LCR83 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

LCR83 Proteins

LCR83 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.