Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

TCTP1

Uniprot No.

P31265

Research Area

Others

Alternative Names

TCTP1

Species

Arabidopsis thaliana (Mouse-ear cress)

Source

E.coli

Expression Region

1-168aa

Target Protein Sequence

MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNIGANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTYDKKGFIAYIKKYIKLLTPKLSEEDQAVFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYKEGSTNPTFLYFAHGLKEVKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.8 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

General regulator required for the development of the entire plant. Regulates the duration of cell cycle. Probable activator of Rab GTPases and upstream regulator of the cell growth-regulating TOR (target of rapamycin) network. Might also control spatial growth in pollen tubes or root hairs via the TORC2 signaling branch. Involved in the regulation of abscisic acid- and calcium-mediated stomatal closure, but not in light or H(+)-pumping induced stomatal opening. May regulate microtubules depolymerization. Binds calcium and has a cytoprotective function.

Gene References into Functions

The 0.3 kb AtTCTP promoter can be used as a plant-derived constitutive promoter for the expression of selectable marker genes, which facilitates its use as an alternative to the 35S promoter for developing genetically engineered crops. PMID: 25410250
TCTP has molecular properties similar to animal TCTPs, such as tubulin- and calcium-binding, and that it functions in ABA-mediated stomatal movement, in addition to regulating the growth of plants. PMID: 22610367
data support a role of plant AtTCTP as a positive regulator of mitotic growth by specifically controlling the duration of the cell cycle. PMID: 20736351
The results identify TCTP as an important regulator of growth in plants and imply a function of plant TCTP as a mediator of TOR activity similar to that known in nonplant systems. PMID: 19060111

Subcellular Location

Cytoplasm, cytosol.

Protein Families

TCTP family

Tissue Specificity

Expressed in flowers, leaves and stems. Expressed in roots and siliques. Detected in seeds. Highest expression in actively dividing and differentiating cell types, such as the meristematic and division zones of the root, the embryo or the elongating tube

Database Links

KEGG: ath:AT3G16640

STRING: 3702.AT3G16640.1

UniGene: At.34389

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP329057DOA
Abbreviation	Recombinant Mouse-ear cress TCTP1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Arabidopsis thaliana Translationally-controlled tumor protein homolog (TCTP)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage