Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

eglD

Uniprot No.

Q96WQ9

Research Area

Others

Alternative Names

eglD; cel61A; AKAW_08531Probable endo-beta-1,4-glucanase D; Endoglucanase D; EC 3.2.1.4; Carboxymethylcellulase D; Cellulase 61A; Cellulase D

Species

Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)

Source

E.coli

Expression Region

21-408aa

Target Protein Sequence

HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

45.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 21-408 form the expressed segment for recombinant Aspergillus kawachii eglD. This eglD protein is expected to have a theoretical molecular weight of 45.2 kDa. Expression of this eglD protein is conducted in e.coli. Fusion of the N-terminal 10xHis tag into the eglD encoding gene fragment was conducted, allowing for easier detection and purification of the eglD protein in subsequent stages.

Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD) primarily functions as an endo-β-1,4-glucanase enzyme, specializing in the hydrolysis of internal glycosidic bonds within cellulose. Its main role is in cellulose degradation, contributing to the breakdown of complex carbohydrates. In the realm of biotechnology and enzyme research, the investigation of eglD provides valuable insights into processes related to cellulose utilization. The potential applications extend to biofuel production and biomass conversion, addressing challenges in sustainable energy. Moreover, eglD's involvement in microbial cellulose degradation makes it pertinent in environmental and agricultural contexts.

Target Background

Function

Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates.

Subcellular Location

Secreted.

Protein Families

Glycosyl hydrolase 61 family

Code	CSB-EP836318APO
Abbreviation	Recombinant Aspergillus kawachii eglD protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage