Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
eglD; cel61A; AKAW_08531Probable endo-beta-1,4-glucanase D; Endoglucanase D; EC 3.2.1.4; Carboxymethylcellulase D; Cellulase 61A; Cellulase D
Species
Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
Expression Region
21-408aa
Target Protein Sequence
HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 21-408 form the expressed segment for recombinant Aspergillus kawachii eglD. This eglD protein is expected to have a theoretical molecular weight of 45.2 kDa. Expression of this eglD protein is conducted in e.coli. Fusion of the N-terminal 10xHis tag into the eglD encoding gene fragment was conducted, allowing for easier detection and purification of the eglD protein in subsequent stages.
Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD) primarily functions as an endo-β-1,4-glucanase enzyme, specializing in the hydrolysis of internal glycosidic bonds within cellulose. Its main role is in cellulose degradation, contributing to the breakdown of complex carbohydrates. In the realm of biotechnology and enzyme research, the investigation of eglD provides valuable insights into processes related to cellulose utilization. The potential applications extend to biofuel production and biomass conversion, addressing challenges in sustainable energy. Moreover, eglD's involvement in microbial cellulose degradation makes it pertinent in environmental and agricultural contexts.