Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP836318APOa4 |
| Product Type | Recombinant Protein |
| Size |
US$2959Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | Q96WQ9 |
| Lead Time | 3-7 business days |
| Relevance | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ |
| Research Area | others |
| Source | Yeast |
| Gene Names | eglD |
| Protein Names | Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A |
| Expression Region | 21-408aa |
| Tag Info | N-terminal 6xHis-sumostar-tagged |
| Mol. Weight | 55.7 kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates (By similarity). |
| Subcellular Location | Secreted |
| Protein Families | Glycosyl hydrolase 61 family |
eglD Antibodies for Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA836318ZA01APO | eglD Antibody | Aspergillus kawachii | ELISA, WB (ensure identification of antigen) |
eglD Proteins for Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP836318APO | Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D(eglD) | Yeast |
| CSB-EP836318APO | Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD) | E.coli |
| CSB-BP836318APO CSB-MP836318APO |
Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D(eglD) | Baculovirus Mammalian cell |
Recombinant Bovine Glycolipid transfer protein(GLTP)
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Ras-related protein Ral-B(RALB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human MARCKS-related protein(MARCKSL1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human C4b-binding protein alpha chain(C4BPA)
Express system: Yeast
Species: Homo sapiens (Human)
