Code | CSB-YP836318APOa4 |
Product Type | Recombinant Protein |
Size |
US$283Purchase it in Cusabio online store (only available for customers from the US) |
Uniprot No. | Q96WQ9 |
Lead Time | 3-7 business days |
Relevance | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates |
Image | |
Storage Buffer | Tris-based buffer,50% glycerol |
Species | Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) |
Purity | Greater than 90% as determined by SDS-PAGE. |
Sequence | HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ |
Research Area | others |
Source | Yeast |
Gene Names | eglD |
Protein Names | Carboxymethylcellulase D Cellulase 61A Cellulase D cel61A |
Expression Region | 21-408aa |
Tag Info | N-terminal 6xHis-sumostar-tagged |
Mol. Weight | 55.7 kDa |
Protein Description | Full Length of Mature Protein |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates (By similarity). |
Subcellular Location | Secreted |
Protein Families | Glycosyl hydrolase 61 family |
eglD Antibodies for Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA836318ZA01APO | eglD Antibody | Aspergillus kawachii | ELISA, WB (ensure identification of antigen) |
eglD Proteins for Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
Code | Product Name | Source |
---|---|---|
CSB-YP836318APO | Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D(eglD) | Yeast |
CSB-EP836318APO | Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D (eglD) | E.coli |
CSB-BP836318APO CSB-MP836318APO |
Recombinant Aspergillus kawachii Probable endo-beta-1,4-glucanase D(eglD) | Baculovirus Mammalian cell |
Recombinant Mouse Endoplasmic reticulum chaperone BiP(Hspa5)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),Partial
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human GTP-binding nuclear protein Ran(RAN)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),Partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human DNA nucleotidylexotransferase(DNTT)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Programmed cell death protein 5(PDCD5)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.