Recombinant Bacillus anthracis Single-stranded DNA-binding protein(ssb)

Code CSB-EP770616BQE
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q81JI3
Relevance Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit th to their sites of action during DNA metabolism.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus anthracis
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF
Research Area Others
Source E.coli
Gene Names ssb
Expression Region 1-172aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 34.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism.
Database Links

KEGG: bar:GBAA_5722

STRING: 260799.BAS5326

Related Products

ssb Antibodies

ssb Antibodies for Bacillus anthracis

ssb Proteins

ssb Proteins for Bacillus anthracis

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.