Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
cry1Ac; cry1A(c); cry218; cryIA(c)Pesticidal crystal protein Cry1Ac; 133 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIA(c)
Species
Bacillus thuringiensis subsp. kurstaki
Expression Region
972-1178aa
Target Protein Sequence
LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Recombinant kurstaki cry1Ac protein is a protein encoded by recombinant DNA that was cloned in an expression vector that supported the expression of cry1Ac gene. This recombinant cry1Ac protein was expressed in the host. The expression region is 972-1178aa of the kurstaki cry1Ac. In the production, the expression vector contains N-terminal GST tag. Every production step was performed with a strict QC system. The purity of this protein is 90%+ determined by SDS-PAGE.
The Cry1Ac protoxin, which is a delta-endotoxin produced during the sporulation phase of Bacillus thuringiensis, has been proposed as an effective and safe alternative adjuvant. When ingested by susceptible larvae, the crystal protein is solubilized and processed, generating the Cry1Ac toxin, which has been widely used as a bioinsecticide. The recombinant Cry1Ac protoxin is immunogenic and adjuvant at the systemic and mucosal level, which can activate antigen presenting cells (APCs) by upregulating costimulatory molecules and increasing the production of pro-inflammatory cytokines. It can confer protective immunity against distinct infection models and remarkably in a murine brucellosis model, it showed the capacity to induce both Th1 and TCD8+ cytotoxic lymphocyte responses, suggesting a potential utility to improve tumor immunity. Beyond this, a study found that a differential adjuvant capacity of Cry1Ac proteins to improve tumor immunity, being the effect of Cry1Ac protoxin outstanding compared with that of Cry1Ac toxin. In addition, Cry1Ac protoxin may confer therapeutic benefit when coadministered with doxorubicin.
