Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ac (cry1Ac), partial

In Stock
Code CSB-EP356448BDC
Abbreviation Recombinant Bacillus thuringiensis subsp. kurstaki cry1Ac protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
cry1Ac
Uniprot No.
Research Area
Others
Alternative Names
cry1Ac; cry1A(c); cry218; cryIA(c)Pesticidal crystal protein Cry1Ac; 133 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIA(c)
Species
Bacillus thuringiensis subsp. kurstaki
Source
E.coli
Expression Region
972-1178aa
Target Protein Sequence
LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.8kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant kurstaki cry1Ac protein is a protein encoded by recombinant DNA that was cloned in an expression vector that supported the expression of cry1Ac gene. This recombinant cry1Ac protein was expressed in the host. The expression region is 972-1178aa of the kurstaki cry1Ac. In the production, the expression vector contains N-terminal GST tag. Every production step was performed with a strict QC system. The purity of this protein is 90%+ determined by SDS-PAGE.

The Cry1Ac protoxin, which is a delta-endotoxin produced during the sporulation phase of Bacillus thuringiensis, has been proposed as an effective and safe alternative adjuvant. When ingested by susceptible larvae, the crystal protein is solubilized and processed, generating the Cry1Ac toxin, which has been widely used as a bioinsecticide. The recombinant Cry1Ac protoxin is immunogenic and adjuvant at the systemic and mucosal level, which can activate antigen presenting cells (APCs) by upregulating costimulatory molecules and increasing the production of pro-inflammatory cytokines. It can confer protective immunity against distinct infection models and remarkably in a murine brucellosis model, it showed the capacity to induce both Th1 and TCD8+ cytotoxic lymphocyte responses, suggesting a potential utility to improve tumor immunity. Beyond this, a study found that a differential adjuvant capacity of Cry1Ac proteins to improve tumor immunity, being the effect of Cry1Ac protoxin outstanding compared with that of Cry1Ac toxin. In addition, Cry1Ac protoxin may confer therapeutic benefit when coadministered with doxorubicin.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Protein Families
Delta endotoxin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*