Recombinant Blattella germanica Allergen Bla g 4

In Stock
Code CSB-EP346597BTL
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P54962
Relevance Probable ligand-binding protein.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP346597BTL could indicate that this peptide derived from E.coli-expressed Blattella germanica (German cockroach) (Blatta germanica) rBla g 4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP346597BTL could indicate that this peptide derived from E.coli-expressed Blattella germanica (German cockroach) (Blatta germanica) rBla g 4.
Storage Buffer Tris-based buffer,50% glycerol
Alias Allergen Bla g IV Allergen: Bla g 4
Species Blattella germanica (German cockroach) (Blatta germanica)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH
Research Area Others
Source E.coli
Expression Region 13-182aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 35.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable ligand-binding protein.
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family

Related Products

Antibodies

Antibodies for Blattella germanica (German cockroach) (Blatta germanica)

Proteins

Proteins for Blattella germanica (German cockroach) (Blatta germanica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.