Home
Protein
Recombinant Proteins
Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5)

Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5)

^{In Stock}

Code	CSB-EP527280BTN
Abbreviation	Recombinant Blomia tropicalis BLOT5 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP527280BTN could indicate that this peptide derived from E.coli-expressed Blomia tropicalis (Mite) BLOT5. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP527280BTN could indicate that this peptide derived from E.coli-expressed Blomia tropicalis (Mite) BLOT5.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

BLOT5

Uniprot No.

O96870

Research Area

Others

Alternative Names

BLOT5Mite allergen Blo t 5; allergen Blo t 5

Species

Blomia tropicalis (Mite)

Source

E.coli

Expression Region

1-134aa

Target Protein Sequence

MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.6kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Expand your research capabilities with our recombinant Blomia tropicalis BLOT5, a full-length protein derived from the mite Blomia tropicalis. Expressed in the 1-134aa region, this protein is produced in E.coli, ensuring an accurate representation and optimal expression for your research needs. With an N-terminal 6xHis-SUMO tag, BLOT5 purification is made easy without compromising protein integrity. Verified by SDS-PAGE to have a purity of over 90%, this lyophilized powder format is perfect for various research applications, making it an essential addition to your ongoing investigations in the mite-derived protein field.