Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
BLOT5Mite allergen Blo t 5; allergen Blo t 5
Species
Blomia tropicalis (Mite)
Expression Region
1-134aa
Target Protein Sequence
MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Expand your research capabilities with our recombinant Blomia tropicalis BLOT5, a full-length protein derived from the mite Blomia tropicalis. Expressed in the 1-134aa region, this protein is produced in E.coli, ensuring an accurate representation and optimal expression for your research needs. With an N-terminal 6xHis-SUMO tag, BLOT5 purification is made easy without compromising protein integrity. Verified by SDS-PAGE to have a purity of over 90%, this lyophilized powder format is perfect for various research applications, making it an essential addition to your ongoing investigations in the mite-derived protein field.
