Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
; Snake venom metalloproteinase leucurolysin-A; Leuc-A; SVMP; EC 3.4.24.-
Species
Bothrops leucurus (Whitetail lancehead)
Expression Region
1-202aa
Target Protein Sequence
QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIFLDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Unlock new possibilities in venom research with our recombinant Bothrops leucurus Leuc-A, a high-quality snake venom metalloproteinase leucurolysin-A (Leuc-A; SVMP) protein. Sourced from the venom of the Whitetail lancehead (Bothrops leucurus), this full-length protein covers the expression region of 1-202aa and is produced in E.coli to ensure exceptional purity and quality.
Our Leuc-A protein comes with N-terminal 10xHis and C-terminal Myc tags for seamless purification and detection, while retaining its original biological activity. With a purity of greater than 85% as determined by SDS-PAGE, this lyophilized powder offers a versatile tool to explore venom-based research applications and develop new therapeutic strategies targeting a wide range of diseases.
