Home
Protein
Recombinant Proteins
Recombinant Bothrops leucurus Snake venom metalloproteinase leucurolysin-A

Recombinant Bothrops leucurus Snake venom metalloproteinase leucurolysin-A

^{In Stock}

Code	CSB-EP308157BIY
Abbreviation	Recombinant Bothrops leucurus Snake venom metalloproteinase leucurolysin-A protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P84907

Research Area

Others

Alternative Names

; Snake venom metalloproteinase leucurolysin-A; Leuc-A; SVMP; EC 3.4.24.-

Species

Bothrops leucurus (Whitetail lancehead)

Source

E.coli

Expression Region

1-202aa

Target Protein Sequence

QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIFLDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

30.5 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Unlock new possibilities in venom research with our recombinant Bothrops leucurus Leuc-A, a high-quality snake venom metalloproteinase leucurolysin-A (Leuc-A; SVMP) protein. Sourced from the venom of the Whitetail lancehead (Bothrops leucurus), this full-length protein covers the expression region of 1-202aa and is produced in E.coli to ensure exceptional purity and quality.

Our Leuc-A protein comes with N-terminal 10xHis and C-terminal Myc tags for seamless purification and detection, while retaining its original biological activity. With a purity of greater than 85% as determined by SDS-PAGE, this lyophilized powder offers a versatile tool to explore venom-based research applications and develop new therapeutic strategies targeting a wide range of diseases.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Non-hemorrhagic metalloproteinase that hydrolyzes the alpha chains of fibrinogen, as well as fibrin, fibronectin and casein. Beta and gamma chains are also hydrolyzed, but more slowly. Thrombolytic activity is also observed. Induces detachment of endothelial cells followed by death, and inhibits endothelial cell adhesion to fibronectin. Induces edema in mouse paw. Inhibits ADP-induced platelet aggregation on human platelet-rich plasma with an IC(50) of 2.8 uM.

Subcellular Location

Secreted.

Protein Families

Venom metalloproteinase (M12B) family, P-I subfamily

Tissue Specificity

Expressed by the venom gland.

Promotions