Recombinant Bovine Guanine nucleotide-binding protein G (t) subunit alpha-2 (GNAT2)

In Stock
Code CSB-EP009599BO
Abbreviation Recombinant Bovine GNAT2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GNAT2
Uniprot No.
Research Area
Neuroscience
Alternative Names
GNAT2; Guanine nucleotide-binding protein G(t) subunit alpha-2; Transducin alpha-2 chain
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
2-354aa
Target Protein Sequence
GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 2-354 constitute the expression domain of recombinant Bovine GNAT2. The expected molecular weight for the GNAT2 protein is calculated to be 44 kDa. This GNAT2 recombinant protein is manufactured in e.coli. The GNAT2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant GNAT2 protein during the following stages.

The bovine guanine nucleotide-binding protein G(t) subunit alpha-2 (GNAT2) is a member of the G protein subunit alpha transducin family. GNAT2 plays a crucial role in visual signal transduction in the retina. Specifically, GNAT2 is involved in the phototransduction cascade within rod and cone cells. Upon absorption of light by photoreceptor cells, GNAT2 is activated, leading to the activation of phosphodiesterase and the hydrolysis of cGMP. This process ultimately results in the closure of cGMP-gated ion channels, hyperpolarization of the photoreceptor cell membrane, and the initiation of visual signal transmission to the brain. Understanding GNAT2's function is essential for unraveling the molecular mechanisms underlying vision and visual signal processing in bovines.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.
Subcellular Location
Cell projection, cilium, photoreceptor outer segment. Photoreceptor inner segment.
Protein Families
G-alpha family, G(i/o/t/z) subfamily
Tissue Specificity
Retinal rod outer segment.
Database Links

KEGG: bta:281795

STRING: 9913.ENSBTAP00000017305

UniGene: Bt.472

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*