Recombinant Bovine Resistin(RETN)

In Stock
Code CSB-EP019573BOa2
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q762I5
Lead Time 3-7 business days
Relevance Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
Research Area Cardiovascular
Source E.coli
Gene Names RETN
Protein Names RSTN
Expression Region 19-109aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 25.6 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes (By similarity).
Subcellular Location Secreted
Protein Families Resistin/FIZZ family
Database Links

KEGG: bta:369020

STRING: 9913.ENSBTAP00000006189

UniGene: Bt.23152

Related Products

RETN Antibodies

RETN Antibodies for Bovine

RETN Proteins

RETN Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.