Recombinant Bovine Resistin (RETN)

In Stock
Code CSB-EP019573BOa2
Abbreviation Recombinant Bovine RETN protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
RETN; RSTN; Resistin
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
19-109aa
Target Protein Sequence
QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine Resistin (RETN) gets produced in E.coli and includes the complete mature protein sequence from amino acids 19 to 109. The protein carries an N-terminal 6xHis-SUMO tag, which helps with purification and detection processes. SDS-PAGE analysis shows the product purity exceeds 85%. This preparation is meant strictly for research purposes and appears to offer a dependable option for experimental work.

Resistin is a cysteine-rich protein that cells secrete, and it seems to be involved in several biological processes like inflammation and how the body handles metabolism. The protein likely plays a significant role in creating insulin resistance and has drawn considerable attention in studies of metabolic and inflammatory pathways. Because resistin participates in these systems, it has become an important target for research into metabolic disorders and how immune responses work.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Bovine Resistin is a hormone involved in insulin resistance and inflammation that requires precise folding, proper disulfide bond formation (with conserved disulfide bonds), and specific tertiary structure for its functional activity in receptor binding and signaling. The E. coli expression system cannot provide the eukaryotic folding environment or oxidative conditions for correct disulfide bond formation. The N-terminal 6xHis-SUMO tag (∼15 kDa) is large relative to the small mature protein (∼10 kDa), which may sterically interfere with the protein's functional domains and receptor-binding interfaces. While the protein may be soluble, the probability of correct folding with functional activity is low without experimental validation.

1. Antibody Development and Validation Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length mature protein provides comprehensive epitope coverage for generating antibodies against bovine resistin. The high purity (>85%) ensures minimal contamination-related issues during immunization protocols.

2. Protein-Protein Interaction Studies

This application carries a significant risk without proper folding validation. Resistin interactions with receptors (e.g., TLR4) require precise tertiary structure and proper disulfide bonding. If correctly folded and active (verified through receptor binding assays), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine interactions.

3. Comparative Species Analysis

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary comparisons of resistin function across species. If misfolded/inactive (unverified), comparative analyses would yield misleading insights about species-specific differences.

4. Biochemical Characterization and Structural Studies

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and disulfide bond analysis. However, the large SUMO tag may dominate the protein's biophysical properties and interfere with high-resolution structural studies.

5. In Vitro Assay Development

This application is well-suited for developing detection assays. The protein serves as an excellent standard for quantitative resistin detection, as immunoassays depend on epitope recognition rather than functional conformation. The high purity and defined concentration ensure reliable assay calibration.

Final Recommendation & Action Plan

The E. coli-expressed bovine resistin with a large SUMO tag may not be properly folded for functional applications due to the lack of eukaryotic disulfide bond formation machinery. Begin with Application 4 (Biochemical Characterization) to assess folding quality through CD spectroscopy, SEC, and validate functional activity using receptor binding assays before considering functional applications. Applications 1 and 5 (antibody development and assay development) can proceed immediately. Applications 2 and 3 require rigorous functional validation. If bioactivity is low, consider using mammalian-expressed resistin for critical functional studies to ensure native conformation and activity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
Subcellular Location
Secreted.
Protein Families
Resistin/FIZZ family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*