Recombinant Bovine Serum amyloid A protein (SAA1)

In Stock
Code CSB-EP020656BO
Abbreviation Recombinant Bovine SAA1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
SAA1; SAA; Serum amyloid A protein; SAA) [Cleaved into: Amyloid protein A; Amyloid fibril protein AA)]
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
19-130aa
Target Protein Sequence
QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of recombinant Bovine SAA1 protein includes the construction of the expression vector containing the recombinant DNA and the transformation of the expression vector into the E.coli, which provides a variety of macromolecules and components required for transcription and translation. The recombinant DNA was formed by fusing the N-terminal 6xHis-SUMO tag and C-terminal Myc tag sequence to the designated sequence encoding the 19-130aa of the Bovine SAA1 protein. This N-terminal 6xHis-tagged recombinant Bovine SAA1 protein is also characterized by high purity, >85%. Under SDS-PAGE condition, this recombinant SAA1 protein migrated to the band of about 33 kDa molecular weight.

SAA1 protein is expressed primarily in the liver and circulates in low levels in the blood. Although its function is not fully understood, serum amyloid A1 appears to play a role in the immune system. SAA1 is closely associated with high-density lipoprotein. Additionally, SAA1 interacts with a number of mammalian proteins. These receptors include the G protein-coupled chemoattractant receptor FPR2. Certain studies indicated that SAA1 might contribute to the development of atherosclerosis. SAA1 is also presented in macrophages and epithelial cells in various tissues. It has been found to enhance local Th17 response in the gut. Other studies have shown that native human SAA1 retains some of the cytokine-like activities such as the G-CSF-induction capability. In a case, the findings suggested that a mutation in the SAA1 promoter causes hereditary amyloid A amyloidosis. Besides, as SAA1 transcriptionally activated by STAT3, it could accelerate renal interstitial fibrosis by inducing endoplasmic reticulum stress; SAA1knockdown promotes the apoptosis of glioblastoma cells via downregulation of AKT signaling.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Why is the molecular weight of this protein 33 kDa? Many literatures show 12kDa.

A:

The molecular weight we provide includes the molecular weight of the tag. The 12kDa you see in the literature should be the molecular weight of 19-130aa, that is, the molecular weight of the target protein without tags.
If you want a smaller tag, CSB-EP020656BOa0 N-terminal 6xHis-tagged is recommended.

Target Background

Function
Major acute phase reactant. Apolipoprotein of the HDL complex.
Gene References into Functions
  1. polymorphisms in the SAA2 gene are associated with milk production traits in Chinese Holstein cows PMID: 26373797
Involvement in disease
Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
Subcellular Location
Secreted.
Protein Families
SAA family
Tissue Specificity
Expressed by the liver; secreted in plasma.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*