Recombinant Caenorhabditis elegans Dauer larva development regulatory growth factor daf-7 (daf-7)

In Stock Promotion
Code CSB-EP311270CXY
Abbreviation Recombinant Caenorhabditis elegans daf-7 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
daf-7
Uniprot No.
Research Area
Others
Species
Caenorhabditis elegans
Source
E.coli
Expression Region
235-350aa
Target Protein Sequence
SHAKPVCNAEAQSKGCCLYDLEIEFEKIGWDWIVAPPRYNAYMCRGDCHYNAHHFNLAETGHSKIMRAAHKVSNPEIGYCCHPTEYDYIKLIYVNRDGRVSIANVNGMIAKKCGCS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Under harsh environmental conditions, larvae enter a developmentally arrested state known as dauer; TGF-beta-like daf-7 acts to inhibit dauer larva formation and promote growth. May be a ligand to cell surface receptor daf-4. May act as a negative regulator of dauer larva development by transducing chemosensory information from ASI neurons. Involved in sensitivity to CO2 levels. In AWC neurons, acts to promote expression of srsx-3, a member of the GPCR family.
Gene References into Functions
  1. DAF-7 expression decreases as animals age during adulthood. Age-dependent diminished expression contributes to the reduced sensitivity of aging animals to the effects of dietary restriction. PMID: 28107363
  2. Using functional, fluorescently-tagged protein, we find that, in animals with mutant DAF-28/IGF, the wild-type DAF-7/TGF-beta is mislocalized to and accumulates in the proximal axon of the ASI neuron. Activation of two different branches of the unfolded protein response can modulate both the developmental phenotype and DAF-7 mislocalization in DAF-28(R37C) animals, but appear to act through divergent mechanisms PMID: 27926939
  3. GLR-1 protein and glr-1 transcription are increased in neurons of DAF-7 mutants. PMID: 26054666
  4. daf-7 has a role in larval development and specifically affects molting and excretory canal development PMID: 23526825
  5. We show that aggregation and bordering are genetically complex, with multiple contributing quantitative trait loci (QTLs), and refine one QTL to identify a new gene affecting the daf-7 pathway, the GABA receptor EXP-1. PMID: 23284308

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Tissue Specificity
Expression in the chemosensory neurons.
Database Links

KEGG: cel:CELE_B0412.2

STRING: 6239.B0412.2

UniGene: Cel.19630

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*