Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Code CSB-EP872766CBG
Abbreviation Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
; Snaclec rhodocytin subunit beta; Aggretin beta chain; Rhodoaggretin subunit beta
Species
Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Source
E.coli
Expression Region
24-146aa
Target Protein Sequence
DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Please can you provide some informations for for expression region,tag and sequence?
Have you received any feedback regarding activity of this protein?

A:
Very nice to receive your inquiry.
Recombinant Calloselasma rhodostoma Rhodocytin subunit beta
CSB-EP872766CBG >> E.coli
Expression Region: 24-146aa; Full length of the mature protein.
Tag information:N-terminal 6xHis-B2M-tagged.
Sequence:

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA


This protein is one of our best-selling proteins, which have been ordered many times, although we haven't received any feedback about the activiy, we also haven't received any after-sales problem about this protein.
What we provide is the full length of the mature protein, and it's purified under very mild condition, in theory, it should be active, however, as we haven't tested the activity, we can't 100% guarantee its activity.
Here is a literature for your reference: https://www.sciencedirect.com/science/article/pii/S0006291X98985163
(Rhodocytin was a disulfide-linked heterodimer consisting of 18- and 15-kDa subunits, Rhodocytin alone induced platelet aggregation.)
We are not sure if a single subunit has this function, it's better to recommend to purchase together with the alpha subunit.
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha
CSB-YP888242CBG >> Yeast
CSB-EP888242CBG >> E.coli
CSB-BP888242CBG >> Baculovirus
CSB-MP888242CBG >> Mammalian cell
Expression Region: 1-136aa; Full length.
Tag information:EP: N-terminal 6xHis-SUMO-tagged;YP: N-terminal 6xHis-tagged; BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for other expression systems:BP, MP: N-terminal 6xHis-tagged
Sequence:

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Target Background

Function
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
Subcellular Location
Secreted.
Protein Families
Snaclec family
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*