Name: Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
Brand: CUSABIO
SKU: CSB-EP872766CBG

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Uniprot No.

Q9I840

Research Area

others

Alternative Names

; Snaclec rhodocytin subunit beta; Aggretin beta chain; Rhodoaggretin subunit beta

Species

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Source

E.coli

Expression Region

24-146aa

Target Protein Sequence

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-B2M-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Please can you provide some informations for for expression region,tag and sequence?
Have you received any feedback regarding activity of this protein?

Very nice to receive your inquiry.
Recombinant Calloselasma rhodostoma Rhodocytin subunit beta
CSB-EP872766CBG >> E.coli
Expression Region: 24-146aa; Full length of the mature protein.
Tag information:N-terminal 6xHis-B2M-tagged.
Sequence:

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA

This protein is one of our best-selling proteins, which have been ordered many times, although we haven't received any feedback about the activiy, we also haven't received any after-sales problem about this protein.
What we provide is the full length of the mature protein, and it's purified under very mild condition, in theory, it should be active, however, as we haven't tested the activity, we can't 100% guarantee its activity.
Here is a literature for your reference: https://www.sciencedirect.com/science/article/pii/S0006291X98985163
(Rhodocytin was a disulfide-linked heterodimer consisting of 18- and 15-kDa subunits, Rhodocytin alone induced platelet aggregation.)
We are not sure if a single subunit has this function, it's better to recommend to purchase together with the alpha subunit.
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha
CSB-YP888242CBG >> Yeast
CSB-EP888242CBG >> E.coli
CSB-BP888242CBG >> Baculovirus
CSB-MP888242CBG >> Mammalian cell
Expression Region: 1-136aa; Full length.
Tag information:EP: N-terminal 6xHis-SUMO-tagged;YP: N-terminal 6xHis-tagged; BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for other expression systems:BP, MP: N-terminal 6xHis-tagged
Sequence:

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Target Background

Function

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Subcellular Location

Secreted.

Protein Families

Snaclec family

Tissue Specificity

Expressed by the venom gland.

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP872766CBG
Abbreviation	Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage