Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Code CSB-EP872766CBG
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Uniprot No. Q9I840
Research Area others
Alternative Names ; Snaclec rhodocytin subunit beta; Aggretin beta chain; Rhodoaggretin subunit beta
Species Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Source E.coli
Expression Region 24-146aa
Target Protein Sequence DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 28.4kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-B2M-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

 Q&A
Q:

Please can you provide some informations for for expression region,tag and sequence?
Have you received any feedback regarding activity of this protein?

A:
Very nice to receive your inquiry.
Recombinant Calloselasma rhodostoma Rhodocytin subunit beta
CSB-EP872766CBG >> E.coli
Expression Region: 24-146aa; Full length of the mature protein.
Tag information:N-terminal 6xHis-B2M-tagged.
Sequence:

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA


This protein is one of our best-selling proteins, which have been ordered many times, although we haven't received any feedback about the activiy, we also haven't received any after-sales problem about this protein.
What we provide is the full length of the mature protein, and it's purified under very mild condition, in theory, it should be active, however, as we haven't tested the activity, we can't 100% guarantee its activity.
Here is a literature for your reference: https://www.sciencedirect.com/science/article/pii/S0006291X98985163
(Rhodocytin was a disulfide-linked heterodimer consisting of 18- and 15-kDa subunits, Rhodocytin alone induced platelet aggregation.)
We are not sure if a single subunit has this function, it's better to recommend to purchase together with the alpha subunit.
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha
CSB-YP888242CBG >> Yeast
CSB-EP888242CBG >> E.coli
CSB-BP888242CBG >> Baculovirus
CSB-MP888242CBG >> Mammalian cell
Expression Region: 1-136aa; Full length.
Tag information:EP: N-terminal 6xHis-SUMO-tagged;YP: N-terminal 6xHis-tagged; BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for other expression systems:BP, MP: N-terminal 6xHis-tagged
Sequence:

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Target Data

Function Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
Subcellular Location Secreted
Protein Families Snaclec family
Tissue Specificity Expressed by the venom gland.

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1