Purity
Greater than 85% as determined by SDS-PAGE.
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression Region
1-371aa
Target Protein Sequence
MTTSPYPIETPFKVCIVGSGNWGTAVAKLVAENCAEKPNIFQRDVKMWVFEEEIEGRKLTEIINTEHENVKYLPEIKLPTNLVANPDIVDTVQDADLIVFNIPHQFLGRIVKQIEGKVKPTARAISCLKGLDVSPEGCKLLSTSITDTLKIYCGVLSGANIANEVAKGNWSETSIAYTVPEDFRGAGKDIDPFILKEAFHRPYFHVRVIEDVVGASIAGALKNVIACSVGFVEGAGWGDNAKAAIMRIGIKETIRFASYWELFKIKALSPPNPKTFTEESAGVADLITTCSGGRNVKVARYMIKNNVDAFEAEKIVLKGQSSQGILTAKEVHELLTNFNLQDEFPLLEATYKVIYENGSVDDFPQLLEGDQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The creation of the recombinant candida albicans Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 (GPD2) refers to the expression of the vector construct in yeast cells. The vector construct is established by cloning the gene fragment that codes for the full-length candida albicans GPD2 protein (1-371aa) along with a C-terminal 6xHis-tag into a plasmid vector. The vector construct containing the desired gene is transfected into the yeast cells. The transfected yeast cells are selected with a special antibiotic and then cultured in a suitable condition. The recombinant candida albicans GPD2 protein is expressed in the yeast cells at the action of the induction reagents. After that, the yeast cells are harvested and lysed to release the cellular contents, including the recombinant GPD2 protein. The recombinant GPD2 protein is purified from the cell lysate and assessed the purity of up to 85% through SDS-PAGE. It appears on a band with a molecular weight of 45 kDa on the gel.
