Home
Protein
Recombinant Proteins
Recombinant Candida albicans Glycerol-3-phosphate dehydrogenase [NAD (+)] 2 (GPD2)

Recombinant Candida albicans Glycerol-3-phosphate dehydrogenase [NAD (+)] 2 (GPD2)

^{In Stock}

Code	CSB-YP4490CZD
Abbreviation	Recombinant Candida albicans GPD2 protein
MSDS	MSDS Datasheet
Size	$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

GPD2

Uniprot No.

Q59W33

Research Area

Others

Species

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Source

Yeast

Expression Region

1-371aa

Target Protein Sequence

MTTSPYPIETPFKVCIVGSGNWGTAVAKLVAENCAEKPNIFQRDVKMWVFEEEIEGRKLTEIINTEHENVKYLPEIKLPTNLVANPDIVDTVQDADLIVFNIPHQFLGRIVKQIEGKVKPTARAISCLKGLDVSPEGCKLLSTSITDTLKIYCGVLSGANIANEVAKGNWSETSIAYTVPEDFRGAGKDIDPFILKEAFHRPYFHVRVIEDVVGASIAGALKNVIACSVGFVEGAGWGDNAKAAIMRIGIKETIRFASYWELFKIKALSPPNPKTFTEESAGVADLITTCSGGRNVKVARYMIKNNVDAFEAEKIVLKGQSSQGILTAKEVHELLTNFNLQDEFPLLEATYKVIYENGSVDDFPQLLEGDQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

42.3 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The creation of the recombinant candida albicans Glycerol-3-phosphate dehydrogenase [NAD(⁺)] 2 (GPD2) refers to the expression of the vector construct in yeast cells. The vector construct is established by cloning the gene fragment that codes for the full-length candida albicans GPD2 protein (1-371aa) along with a C-terminal 6xHis-tag into a plasmid vector. The vector construct containing the desired gene is transfected into the yeast cells. The transfected yeast cells are selected with a special antibiotic and then cultured in a suitable condition. The recombinant candida albicans GPD2 protein is expressed in the yeast cells at the action of the induction reagents. After that, the yeast cells are harvested and lysed to release the cellular contents, including the recombinant GPD2 protein. The recombinant GPD2 protein is purified from the cell lysate and assessed the purity of up to 85% through SDS-PAGE. It appears on a band with a molecular weight of 45 kDa on the gel.