Recombinant Clostridium tetani Tetanus toxin (tetX), partial

In Stock
Code CSB-EP356416CMN
Abbreviation Recombinant Clostridium tetani tetX protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
tetX
Uniprot No.
Research Area
others
Alternative Names
tetX; CTC_p60; Tetanus toxin; EC 3.4.24.68; Tentoxylysin) [Cleaved into: Tetanus toxin light chain; Tetanus toxin chain L); Tetanus toxin heavy chain; Tetanus toxin chain H)]
Species
Clostridium tetani (strain Massachusetts / E88)
Source
E.coli
Expression Region
2-457aa
Target Protein Sequence
PITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
66.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Clostridium tetani Tetanus toxin (tetX) gets produced in E. coli and includes an N-terminal 6xHis-B2M tag that makes purification and detection more straightforward. This partial protein covers amino acids 2-457 and shows purity levels exceeding 85%, as confirmed through SDS-PAGE analysis. The product is designed strictly for research purposes and appears to provide a reliable source of tetanus toxin for different experimental work.

Clostridium tetani produces the naturally occurring tetanus toxin, which is recognized for its powerful neurotoxic properties that disrupt normal muscle contractions. It has become important in neurological research because of how it blocks neurotransmitter release at synapses, ultimately causing muscle paralysis. Getting a better grasp of its mechanism may be key for creating strategies to combat its effects and enhance therapeutic approaches.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Clostridium tetani Tetanus toxin is a complex neurotoxin that requires precise folding, proper disulfide bond formation, proteolytic cleavage into heavy and light chains, and specific tertiary structure for its functional activity in neuronal binding and toxicity. The E. coli expression system cannot provide the necessary folding environment for this large bacterial toxin, including correct disulfide bonding or proteolytic processing. The N-terminal 6xHis-B2M tag is large (B2M is ~12 kDa) and may sterically interfere with the protein's folding and functional domains. The partial fragment (2-457aa) represents only a portion of the full-length toxin (1315aa) and lacks critical domains required for toxicity, such as the complete binding and catalytic regions. Therefore, the probability of correct folding with bioactivity is extremely low without experimental validation.

1. Antibody Development and Characterization

This application has significant limitations. Antibody development relies on antigenic epitopes, but the partial fragment with a large foreign tag may not present conformational epitopes found in the native toxin. Antibodies generated may primarily target the tag or linear sequences, and might not efficiently recognize the full-length, properly folded tetanus toxin. If correctly folded (verified), it could be suitable for linear epitope recognition; if misfolded (unverified), antibody specificity may be poor and not applicable to native toxin studies.

2. Biochemical and Structural Analysis

Basic biochemical and biophysical characterization can be performed, but results will not reflect the native toxin's structure. Techniques like circular dichroism or mass spectrometry can assess the fragment's properties, but the lack of full-length context, potential misfolding, and large tag mean data may be irrelevant to the native protein. If correctly folded (verified), limited insights may be gained; if misfolded (unverified), characterization describes an artificial construct.

Final Recommendation & Action Plan

This recombinant tetanus toxin fragment expressed in E. coli with a large B2M tag is unsuitable for functional studies due to the essential requirements for proper folding, disulfide bonding, and proteolytic processing that cannot be met in this system. Application 1 (antibody development) can proceed with severe limitations. Interaction studies and functional studies should be avoided entirely due to the high risk of artefacts. Application 2 (biochemical characterization) provides only basic insights into the recombinant fragment, not the native toxin. For reliable tetanus toxin research, use full-length or correctly processed fragments expressed in eukaryotic systems or native toxin preparations, with rigorous functional validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln-|-Phe-77' bond of synaptobrevin-2.
Protein Families
Peptidase M27 family
Database Links

KEGG: ctc:CTC_p60

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*