Purity
            Greater than 90% as determined by SDS-PAGE.
           
                                                                                
                                        
                              
            Alternative Names
            
              Thrombin-like enzyme crotalase; SVTLE; EC 3.4.21.74; Fibrinogen-clotting enzyme; Snake venom serine protease 2; SVSP
             
           
                                        
            Species
            Crotalus adamanteus (Eastern diamondback rattlesnake)
           
                              
                              
            Expression Region
            25-262aa
           
                              
            Target Protein
              Sequence            
            VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP
              Note: The complete
                sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
                translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
                
If the exact amino acid sequence of this recombinant protein is critical to your application,
                please explicitly request the full and complete sequence of this protein before ordering.
                          
           
                              
                              
            Protein Length
            Full Length of Mature Protein
           
                                        
            Tag Info
            
                                          N-terminal 6xHis-SUMO-tagged
                          
           
                              
            Form
            
                            Liquid or Lyophilized powder                             
              Note: We will preferentially ship the format that
                we have in stock, however, if you have any special requirement for the format, please remark your
                requirement when placing the order, we will prepare according to your demand.
                          
           
                    
            Buffer
                          If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
              
              Note: If you have any special requirement for the
                glycerol content, please remark when you place the order.
              
              If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
              6% Trehalose.
                          
           
                                                  
            Reconstitution
            We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
           
                    
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
            Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.            
           
                    
            Notes
            Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
           
                    
            Datasheet & COA
             Please contact us to get it.