Recombinant Danio rerio Spindle and kinetochore-associated protein 2(ska2)

Product Type Recombinant Protein
Uniprot No. Q0P426
Abbreviation ska2
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Gene Names ska2
Protein Names Recommended name: Spindle and kinetochore-associated protein 2 Alternative name(s): Protein FAM33A
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it is required for ska1 localization. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules.
Subcellular Location Cytoplasm, cytoskeleton, spindle, Chromosome, centromere, kinetochore
Protein Families SKA2 family
Database Links

STRING: 7955.ENSDARP00000010089

UniGene: Dr.83495

Product Details for Different Expression Systems

Product Name Recombinant Danio rerio Spindle and kinetochore-associated protein 2(ska2),Yeast
Code CSB-YP603899DIL
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence METVDKLEAMFQKAEADIEYVEKRLKFDFMASAREAGTFEGNPVELLEDLSAIKARHAAL CAQVEEIAAEQKRSMDSIRAHLDTTVQLVQQLQNTADVQVPPLTEEEQEARDALCSSVAA LNVEAMPTSEPQSQAQSEAQNVHEDVSEKTFETVPRSVRGNLKLKDLNALYKQLFEHFSD KSRGPISTQRMKKLNMKVNDSALKTLQHLKLIELDKKGLVSLLAND
Expression Region 1-226
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Danio rerio Spindle and kinetochore-associated protein 2(ska2),E.coli
Code CSB-EP603899DIL
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence METVDKLEAMFQKAEADIEYVEKRLKFDFMASAREAGTFEGNPVELLEDLSAIKARHAAL CAQVEEIAAEQKRSMDSIRAHLDTTVQLVQQLQNTADVQVPPLTEEEQEARDALCSSVAA LNVEAMPTSEPQSQAQSEAQNVHEDVSEKTFETVPRSVRGNLKLKDLNALYKQLFEHFSD KSRGPISTQRMKKLNMKVNDSALKTLQHLKLIELDKKGLVSLLAND
Expression Region 1-226
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Danio rerio Spindle and kinetochore-associated protein 2(ska2),Baculovirus
Code CSB-BP603899DIL
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence METVDKLEAMFQKAEADIEYVEKRLKFDFMASAREAGTFEGNPVELLEDLSAIKARHAAL CAQVEEIAAEQKRSMDSIRAHLDTTVQLVQQLQNTADVQVPPLTEEEQEARDALCSSVAA LNVEAMPTSEPQSQAQSEAQNVHEDVSEKTFETVPRSVRGNLKLKDLNALYKQLFEHFSD KSRGPISTQRMKKLNMKVNDSALKTLQHLKLIELDKKGLVSLLAND
Expression Region 1-226
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Danio rerio Spindle and kinetochore-associated protein 2(ska2),Mammalian cell
Code CSB-MP603899DIL
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence METVDKLEAMFQKAEADIEYVEKRLKFDFMASAREAGTFEGNPVELLEDLSAIKARHAAL CAQVEEIAAEQKRSMDSIRAHLDTTVQLVQQLQNTADVQVPPLTEEEQEARDALCSSVAA LNVEAMPTSEPQSQAQSEAQNVHEDVSEKTFETVPRSVRGNLKLKDLNALYKQLFEHFSD KSRGPISTQRMKKLNMKVNDSALKTLQHLKLIELDKKGLVSLLAND
Expression Region 1-226
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

ska2 Antibodies

ska2 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.