Recombinant Drosophila melanogaster Peptidoglycan-recognition protein SC2 (PGRP-SC2)

In Stock
Code CSB-EP892684DLU
Abbreviation Recombinant Drosophila melanogaster PGRP-SC2 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PGRP-SC2
Uniprot No.
Research Area
Others
Species
Drosophila melanogaster (Fruit fly)
Source
E.coli
Expression Region
21-184aa
Target Protein Sequence
VTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene fragment encoding the 21-184aa of the Drosophila melanogaster peptidoglycan-recognition protein SC2 (PGRP-SC2) was co-expressed with the N-terminal 10xHis-tag and C-terminal Myc-tag in the E.coli. The resulting protein is the recombinant Drosophila melanogaster PGRP-SC2 protein. Its purity is greater than 90% determined by SDS-PAGE. Importantly, this recombinant Drosophila melanogaster PGRP-SC2 protein has been cited by a high score-IF paper.

As its name implies, PGRP-SC2 being an amidase degrades bacterial peptidoglycan (PGN) and thus participates in innate immunity. PGRP-SC2 is the homolog of the anti-inflammatory molecules PGLYRP1-4 and is a negative regulator of dampening immune deficiency (IMD)/Relish innate immune signaling. Linlin Guo et al. demonstrated that in the aging intestine of Drosophila, chronic activation of Foxo decreases expression of PGRP-SC2, inhibition of which results in deregulation of Rel/NFκB activity, leading to commensal dysbiosis, stem cell hyperproliferation, and epithelial dysplasia. Overexpression of PGRP-SC2 in enterocytes prevents dysbiosis, promotes tissue homeostasis, and extends lifespan. Yuchen Chen et al. showed that flies bearing malignant yki3SA-gut tumors cause bacterial overload through the inhibition of gut PGRP-SC2 and consequent systemic IMD-NF-κB activation.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 2 reviews

Submit a Review here

Applications : In vitro enzyme activity assay

Review: I conducted in vitro enzyme activity assay experiments using PGRP-SC2 protein (Code: CSB-EP892684DLU), and the results showed that the purified PGRP-SC2 protein can effectively perform its amidase activity. The Drosophila PGRP-SC2 protein produced and purified by this company works very well.

By Anonymous

Applications : ELISA assays

Review: PGRP-SC2 overexpression consistently decreased circulating PGN concentrations in the hemolymph and systemic expression of IMD-NF-kB target genes.

By Anonymous

Target Background

Function
N-acetylmuramyl-L-alanine amidase involved in innate immunity by degrading bacterial peptidoglycans (PGN). Probably plays a scavenger role by digesting biologically active PGN into biologically inactive fragments. Has no direct bacteriolytic activity.
Gene References into Functions
  1. The aging intestine of Drosophila, chronic activation of the transcription factor Foxo reduces expression of peptidoglycan recognition protein SC2 (PGRP-SC2), a negative regulator of IMD/Relish innate immune signaling, and homolog of the anti-inflammatory molecules PGLYRP1-4. PMID: 24439372
  2. Report that PGRP-SC1/2-depleted flies present over-activation of the immune deficiency signaling pathway after bacterial challenge suggesting that these proteins act in the larval gut to prevent activation of this pathway following bacterial ingestion. PMID: 16518472
Subcellular Location
Secreted.
Protein Families
N-acetylmuramoyl-L-alanine amidase 2 family
Tissue Specificity
Constitutively expressed at high level in gut, in addition to the induced expression in fat body.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*