Recombinant Drosophila melanogaster Protein wingless (wg)

Code CSB-YP362746DLU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP362746DLU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP362746DLU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP362746DLU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP362746DLU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
wg
Uniprot No.
Alternative Names
wg; CG4889; Protein wingless; Protein Wnt-1; Protein int-1; dInt-1; dWnt-1
Species
Drosophila melanogaster (Fruit fly)
Expression Region
18-468
Target Protein Sequence
GSSLSQVEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLVRDNPG VLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAA VTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSR EFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVI GDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERM LNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNP EHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEV VVVERCACTFHWCCEVKCKLCRTKKVIYTCL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds as a ligand to a family of frizzled seven-transmembrane receptors and acts through a cascade of genes on the nucleus. Segment polarity protein. May be a growth factor. Acts on neighboring cells to regulate at least one gene, the homeobox segmentation gene engrailed. Wg signal represses arm phosphorylation. Wg signaling operates by inactivating the sgg repression of engrailed autoactivation. Wg and Wnt2 have a role in the developing trachea and together are responsible for all dorsal trunk formation. Wg also acts in the developing epidermis. Acts as a morphogen, and diffuses long distances despite its lipidation. Lipophorin is required for diffusion, probably by acting as vehicle for its movement, explaining how it can spread over long distances despite its lipidation. In non-neuronal cells, wls directs wg secretion via clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps26 and Vps35) to sustain a wls traffic loop encompassing the Golgi, the cell surface, an endocytic compartment and a retrograde route leading back to the Golgi. In neuronal cells (the larval motorneuron NMJ), wg signal moves across the synapse through the release of wls-containing exosome-like vesicles.
Gene References into Functions
  1. Wingless and Hedgehog signaling have opposite effects on epithelial fold depth at the boundary that correlate with changes in Baz planar polarity in the early embryo. PMID: 29691225
  2. epithelia-derived Wg plays a repulsive role in regulating the directional growth of dendrites through the non-canonical Wnt pathway. PMID: 27129721
  3. hypothesize that VAMP7 is required for Wg intracellular trafficking and the accumulation of Wg in Rab4-dependent recycling endosomes might affect Wg signaling PMID: 29065163
  4. The current study further solidified the role of STAT and Wg in regeneration, by identifying their contribution to abnormal regenerations induced by IR. STAT92E (Drosophila STAT3/5) and Nurf-38, which encodes a member of the Nucleosome Remodeling Factor complex, oppose each other in these cells to modulate the frequency of ectopic disc growth PMID: 29028797
  5. Notum normally functions to coordinate synaptic structural and functional differentiation via negative regulation of Wg trans-synaptic signaling in the extracellular synaptomatrix. PMID: 28860114
  6. This study identify Cortactin is a presynaptic effector molecule of the Wingless/Wnt signal. PMID: 28123080
  7. Resistance to ionizing radiation-induced apoptosis requires STAT and Wg and is mediated by transcriptional repression of the pro-apoptotic gene reaper. PMID: 27584613
  8. An absolute requirement for Armadillo for activation and repression of Wingless protein target genes.Pan protein regulates Wingless-responsive enhancers. PMID: 28369070
  9. a previously unknown role of dFoxO in promoting Wg signaling, and that a dFoxO-Arm complex is likely involved in their mutual functions, e.g. cell death. PMID: 26936649
  10. Dysfunction of Wntless triggers the retrograde Golgi-to-ER transport of Wingless and induces ER stress. PMID: 26887613
  11. a Wingless (Wg) morphogen gradient patterns the peripheral specialization of the fly eye. PMID: 26428511
  12. Cow promotes the apical transport of Wg, independent of Dlp and endocytosis. PMID: 25360738
  13. showed that the v-SNARE protein Sec22 and Wg are packaged together with p24 proteins PMID: 26002470
  14. compared the activity of cis-regulatory sequences (enhancers) across the wg locus in D. guttifera and D. melanogaster and found strong functional conservation among the enhancers that control similar patterns of wg expression in larval imaginal discs PMID: 26034272
  15. Modulating Wg signaling can modify Yki-mediated suppression of eye fate. PMID: 25977365
  16. we show that the intersection of extrinsic hedgehog(hh) and WNT/wingless (wg) signaling with the tube-intrinsic Hox code of distinct segments specifies the tube pattern and shape of the Drosophila airways PMID: 25615601
  17. The heterotrimeric G protein Go functions as a transducer of Wingless-Frizzled 2 signaling in the synapse and Ankyrin 2 as a target of Go signaling required for neuromuscular junction formation PMID: 25139856
  18. The secreted peptide Wingless acts as a downstream effector of MED13 to mediate cross-talk with adipose tissue and suppress obesity. PMID: 24979807
  19. endocytosis of Wg requires a specific endocytosis regulator (Mop) implying that Wg signaling is mediated by special endocytic pathways. PMID: 24821423
  20. analysis of transcriptional regulation in the formation of a Wg gradient in the Drosophila wing disc PMID: 24917503
  21. the spread of Wingless is dispensable for patterning and growth even though it probably contributes to increasing cell proliferation PMID: 24390349
  22. Data suggest that Wingless is not required during the early stages of disc regeneration. PMID: 23878228
  23. vertebrate and Drosophila Sulfs have an intrinsically similar activity and the function of Sulfs in the fate of Wnt/Wg ligands is context-dependent PMID: 23300081
  24. Reducing canonical Wg/Wnt signaling alleviates the locomotor defects and premature death of flies expressing mutant huntingtin (Htt) in neurons or glial cells. PMID: 22531500
  25. It was demonstrated that Wingless from the undifferentiated progenitor cell, the enteroblast, is required for Myc-dependent intestinal stem cell proliferation during regeneration. PMID: 22948071
  26. Hipk proteins have a role independent of their effect on beta-catenin/Armadillo stability to enhance Wnt/Wingless signaling. PMID: 22634475
  27. HP1a binds to the same wg enhancer element as Eyg. PMID: 22547675
  28. data demonstrate the in vivo roles of N-glycosylation and lipid modification in Wg secretion and signaling PMID: 22285813
  29. DSNX3 regulates Wg secretion via retromer-dependent Wls recycling PMID: 22041890
  30. Data suggest that Crinkled acts in concert with Wingless targets to orchestrate the proper shaping of denticles in the Drosophila embryonic epidermis. PMID: 22219350
  31. the posterior band of Wg expression is diminished in strength, indicating a positive feedback loop required for Wg robust expression at the cellular blastoderm stage. PMID: 21821151
  32. Endomembrane-mediated processes contribute to the spread and maintenance of the Wingless gradient of the wing disc. PMID: 21654212
  33. wnt spreading is impaired in the retina of Sfrp1(-/-);Sfrp2(-/-) mice, but forced expression of Sfrp1 in the wing imaginal disc of Drosophila suppresses some effects of Wg PMID: 21896628
  34. overexpression of the vesicular traffic protein H rs capable of inhibiting the Wg signaling agree with the notion on antagonism of Wg and Ey in ectopic eyes PMID: 21954610
  35. propose that dimorphic Wg regulation, in concert with monomorphic segment-specific programmed cell death, are the principal mechanisms of sculpting the sexually dimorphic abdomen PMID: 21690416
  36. Data show that sulf1 is specifically up-regulated by Wg signaling in the wing disc. We found that expression of Wg target gene senseless (sens) was elevated in the sulf1 mutant wing discs. PMID: 21305649
  37. Wg signaling transduction in Drosophila heart development PMID: 20933213
  38. Dlp shows biphasic activity in Wingless/Wnt signaling and distribution. PMID: 20816203
  39. wingless signaling regulates cone cell specification in the Drosophila retina PMID: 20140910
  40. identified a wg enhancer that regulates ectopic wg expression. Deletion of this enhancer increases transdetermination, but lowers the amount of ectopic Wg. PMID: 20816798
  41. Wingless morphogen gradient formation is regulated by Drosophila heparan sulfate 6-O endosulfatase PMID: 20637191
  42. A balance of ubiquitylation and deubiquitylation of the Wg/Wnt receptor Frizzled determines the cellular responsiveness to Wg/Wnt both in mammalian cells and in Drosophila. PMID: 20495530
  43. Wg negatively regulates the function of Ssp by changing its subcellular localization in the salivary gland. PMID: 20430750
  44. data suggest a novel link between canonical Wnt signaling and epithelial structure that requires activation of the Rho1 pathway and Myosin II. PMID: 20102708
  45. Coop antagonizes the binding of Armadillo to Pangolin, providing a mechanism for Coop-mediated repression of Wg target gene transcription PMID: 20439429
  46. in the epidermis of the embryo two signaling molecules, Hedgehog (Hh) and Wingless (Wg or Wnt1), provide directional cues that induce the proper orientation of actin-rich structures in the larval cuticle PMID: 17183721
  47. Data showed that Wingless was relatively constant in abundance and thus provided a homogeneous growth-promoting signal. PMID: 19809090
  48. combgap relays wingless signal reception to the determination of cortical cell fate in the visual system PMID: 11106753
  49. RNA targeting promotes proper Wg signaling in early Drosophila embryos and contributes to the establishment of apical and basal polarity of polarized epithelium, until now generally accepted to be generated by protein sorting in the trans-Golgi network. PMID: 11752665
  50. posttranslational N-glycosylation in the endoplasmic reticulum by porcupine gene product PMID: 11821428

Show More

Hide All

Subcellular Location
Secreted. Cell junction, synapse. Membrane; Lipid-anchor. Secreted, extracellular space, extracellular matrix.
Protein Families
Wnt family
Tissue Specificity
Segmented expression in embryos. In embryonic tracheal cells, expression is in stripes flanking the tracheal placode.
Database Links

KEGG: dme:Dmel_CG4889

STRING: 7227.FBpp0079060

UniGene: Dm.6628

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1