Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Ect4

Uniprot No.

Q6IDD9

Research Area

Others

Alternative Names

(NADase sarm1)(Sterile alpha and TIR motif-containing protein 1)(Tir-1 homolog)

Species

Drosophila melanogaster (Fruit fly)

Source

E.coli

Expression Region

370-678aa(A386L,H392R,T433V,T434A,L595S,A596D,H599Q)

Target Protein Sequence

KSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIASKFAAQALRLIGET
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

37.0 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In expressing the recombinant Drosophila melanogaster (Fruit fly) Ect4 protein, e.coli cells are transfected with a DNA expression vector that harbors the gene for the desired protein (370-678aa(A386L,H392R,T433V,T434A,L595S,A596D,H599Q)). The cultured cells then express the intended protein. The protein is equipped with a N-terminal 6xHis tag. The recombinant Drosophila melanogaster (Fruit fly) Ect4 protein is collected and purified from the cell lysate through affinity purification, achieving a purity surpassing 85%, as confirmed by SDS-PAGE.

Target Background

Function

NAD(+) hydrolase, which plays a key role in axonal degeneration following injury by regulating NAD(+) metabolism. Acts as a negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway by promoting Wallerian degeneration, an injury-induced form of programmed subcellular death which involves degeneration of an axon distal to the injury site. Wallerian degeneration is triggered by NAD(+) depletion: in response to injury, it is activated and catalyzes cleavage of NAD(+) into ADP-D-ribose (ADPR), cyclic ADPR (cADPR) and nicotinamide; NAD(+) cleavage promoting axon destruction. Involved in the down-regulation of the tracheal immune response to Gram-negative bacteria. This is likely by mediating Tollo signaling in the tracheal epithelium.

Gene References into Functions

In Ect4 knockdown flies Drosophila C virus-induced mortality occurred more quickly and virus accumulation was increased. PMID: 27960110
findings show that loss of dSarm (sterile alpha/Armadillo/Toll-Interleukin receptor homology domain protein) cell-autonomously suppresses Wallerian degeneration for weeks after axotomy; results provide direct evidence that axons actively promote their own destruction after injury PMID: 22678360

Subcellular Location

Cytoplasm. Cell projection, axon.

Tissue Specificity

Widely expressed in larval brains and adult brains.

Database Links

KEGG: dme:Dmel_CG43119

STRING: 7227.FBpp0293535

UniGene: Dm.5517

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP764228DLU1(M)
Abbreviation	Recombinant Drosophila melanogaster Ect4 protein (Mutant type), partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Drosophila melanogaster Sterile alpha and TIR motif-containing protein 1 (Ect4) (A386L,H392R,T433V,T434A,L595S,A596D,H599Q), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage