Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY),Biotinylated

In Stock
Code CSB-EP366179EDZg10-B
Abbreviation Recombinant Enterobacteria phage T4 uvsY protein, Biotinylated
MSDS
Size $466
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
uvsY
Uniprot No.
Research Area
Others
Species
Enterobacteria phage T4 (Bacteriophage T4)
Source
E.coli
Expression Region
1-137aa
Target Protein Sequence
MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
63.6kDa
Protein Length
Full Length
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Enterobacteria phage T4 Recombination protein uvsY is produced in E. coli with an N-terminal MBP-tag and a C-terminal 6xHis-Avi-tag, which makes detection and purification more straightforward. The protein expresses as a full-length version spanning amino acids 1-137. SDS-PAGE analysis confirms purity levels greater than 85%. This biotinylated protein appears suitable for various research applications, though it's designated for research use only.

The uvsY protein from Enterobacteria phage T4 acts as a recombination mediator protein. It seems to play a crucial role in homologous recombination by helping pair homologous DNA strands. During presynaptic filament assembly, it works alongside other recombination proteins. Scientists studying DNA repair mechanisms and the molecular processes behind genetic exchange in phage biology may find this protein particularly valuable.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Enterobacteria phage T4 Recombination protein UvsY is a small (137 aa) protein that requires precise folding, proper oligomerization (hexamer formation), and specific tertiary structure for its functional activity in DNA recombination. The E. coli expression system is homologous to this phage protein, which increases the probability of correct folding at the domain level. However, the large N-terminal MBP tag (∼40 kDa) is significantly larger than the UvsY protein itself (∼15 kDa) and will severely sterically interfere with the protein's oligomerization interfaces and functional domains. While the protein may be correctly folded at the primary structure level, the probability of forming functional oligomers with proper bioactivity is extremely low due to the massive tag interference.

1. Antibody Development

This application has significant limitations. While antibodies can be generated against linear epitopes, the immune response will primarily target the large foreign MBP tag rather than the small UvsY domain. Antibodies may not recognize the native, properly oligomerized UvsY in its physiological context, and will likely have poor specificity for the actual functional protein.

2. Biophysical Characterization

Basic biophysical analysis can be performed, but will not reflect native UvsY structure or oligomerization. Techniques like circular dichroism spectroscopy or dynamic light scattering will primarily detect the large MBP tag's properties rather than the UvsY domain's characteristics. The tag will dominate all physical measurements, making results biologically irrelevant for understanding native UvsY biophysics.

Final Recommendation & Action Plan

This MBP-tagged UvsY construct is unsuitable for meaningful biophysical characterization due to the severe steric interference from the massive MBP tag (40 kDa) relative to the small UvsY protein (15 kDa). While antibody development is technically possible, the resulting antibodies will primarily recognize the tag rather than the native protein. For reliable UvsY research, use tag-free or small-tag constructs that preserve the protein's oligomerization capability and functional interfaces. Biophysical studies should be conducted with properly folded, untagged protein to obtain biologically relevant data.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.
Gene References into Functions
  1. UvsY globally stabilizes UvsX-ssDNA complexes, consistent with an increase in the apparent equilibrium binding affinity, K(ss)omega, of the UvsX-ssDNA interactions. PMID: 16634631
  2. results support a mechanism in which the formation of competent presynaptic filaments requires a hand-off of ssDNA from UvsY to UvsX, with the efficiency of the hand-off controlled by the relative ssDNA-binding affinities of the two proteins. PMID: 19244311
Database Links

KEGG: vg:1258547

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*