Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
uvsY; Recombination protein uvsY
Species
Enterobacteria phage T4 (Bacteriophage T4)
Expression Region
1-137aa
Target Protein Sequence
MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Intact Enterobacteria phage T4 Recombination protein uvsY (uvsY) cDNA (1-137aa) with an N-terminal 6xHis--SUMO-tag was expressed in the E.coli. The forming protein is the Recombinant full-length Enterobacteria phage T4 uvsY protein. The purity of this protein is greater than 90% as determined by SDS-PAGE. Under reducing conditions, the SDS-PAGE gel showed a molecular weight band of about 33 kDa. And this uvsY protein also underwent the validation by the LC-MS/MS analysis. This uvsY protein is in-stock so that there is no waiting period for product preparation. It may find uses for specific antibody synthesis or in the studies of homologous recombination (HR).
UVSY is the phage T4 recombination mediator protein (RMP) that is crucial for efficient HR in bacteriophage T4 and is the functional analog of the eukaryotic Rad52 protein. HR has important roles in repairing double-stranded DNA (dsDNA) break repair, restarting the stalled replication forks, and recombination-dependent replication. UVSY is specifically recruited to ssDNA–Gp32 complexes and promotes the dissociation of Gp32, thus stimulating the DNA-dependent ATPase activity of recombinase UVSX and facilitating the strand exchange.
