Recombinant Enterobacteria phage T4 Recombination protein uvsY(uvsY)

In Stock
Code CSB-EP366179EDZ
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP366179EDZ could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) uvsY.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP366179EDZ could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) uvsY.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

Intact Enterobacteria phage T4 Recombination protein uvsY (uvsY) cDNA (1-137aa) with an N-terminal 6xHis--SUMO-tag was expressed in the E.coli. The forming protein is the Recombinant full-length Enterobacteria phage T4 uvsY protein. The purity of this protein is greater than 90% as determined by SDS-PAGE. Under reducing conditions, the SDS-PAGE gel showed a molecular weight band of about 33 kDa. And this uvsY protein also underwent the validation by the LC-MS/MS analysis. This uvsY protein is in-stock so that there is no waiting period for product preparation. It may find uses for specific antibody synthesis or in the studies of homologous recombination (HR).

UVSY is the phage T4 recombination mediator protein (RMP) that is crucial for efficient HR in bacteriophage T4 and is the functional analog of the eukaryotic Rad52 protein. HR has important roles in repairing double-stranded DNA (dsDNA) break repair, restarting the stalled replication forks, and recombination-dependent replication. UVSY is specifically recruited to ssDNA–Gp32 complexes and promotes the dissociation of Gp32, thus stimulating the DNA-dependent ATPase activity of recombinase UVSX and facilitating the strand exchange.

Purity Greater than 90% as determined by SDS-PAGE.
Target Names uvsY
Uniprot No. P04537
Research Area Others
Alternative Names uvsY; Recombination protein uvsY
Species Enterobacteria phage T4 (Bacteriophage T4)
Source E.coli
Expression Region 1-137aa
Target Protein Sequence MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 31.8kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.
Gene References into Functions
  1. UvsY globally stabilizes UvsX-ssDNA complexes, consistent with an increase in the apparent equilibrium binding affinity, K(ss)omega, of the UvsX-ssDNA interactions. PMID: 16634631
  2. results support a mechanism in which the formation of competent presynaptic filaments requires a hand-off of ssDNA from UvsY to UvsX, with the efficiency of the hand-off controlled by the relative ssDNA-binding affinities of the two proteins. PMID: 19244311
Database Links

KEGG: vg:1258547

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1