Home
Protein
Recombinant Protein
Recombinant Escherichia phage T7 DNA helicase/primase,partial

Recombinant Escherichia phage T7 DNA helicase/primase,partial

^{In Stock}

Code	CSB-EP356120EEB
MSDS	MSDS
Size	US$388
	Order now
Image	Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356120EEB could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356120EEB could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P03692

Research Area

Signal Transduction

Alternative Names

DNA primase/helicase; Gene product 4; Gp4

Species

Escherichia phage T7 (Bacteriophage T7)

Source

E.coli

Expression Region

151-548aa

Target Protein Sequence

KKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

51.3 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

ATP-dependent DNA helicase and primase essential for viral DNA replication and recombination. The helicase moves 5' -> 3' on the lagging strand template, unwinding the DNA duplex ahead of the leading strand polymerase at the replication fork and generating ssDNA for both leading and lagging strand synthesis. ATP or dTTP hydrolysis propels each helicase domain to translocate 2 nt per step sequentially along DNA. Mediates strand transfer when a joint molecule is available and participates in recombinational DNA repair through its role in strand exchange. Primase activity synthesizes short RNA primers at the sequence 5'-GTC-3' on the lagging strand that the polymerase elongates using dNTPs and providing the primase is still present.

Gene References into Functions

structural model of a bacteriophage T7 DNA helicase-DNA polymerase complex PMID: 22977246
Zinc-binding domain of the bacteriophage T7 DNA primase modulates binding to the DNA template PMID: 23024359
Data show that tryptophans Trp-42, -97, and -147 play different but essential roles in T7 DNA primase. PMID: 22605336
The ligation state of the zinc ion was examined by X-ray absorption spectroscopy and biochemical analysis of genetically altered primases, was analysed. PMID: 19206208
thioredoxin-binding domain of T7 DNA polymerase is the site of interaction of the phage-encoded helicase/primase (gp4) and ssDNA binding protein (gp2.5) PMID: 15795374
residues Glu-157, Glu-159, Asp-161, Asp-207, Asp-209, and Asp-237 are essential for binding affinity for ATP PMID: 15917241
The switch in contacts between Asp(263) and Tyr(411), Lys(408), or Arg(404) in helix E of the adjacent subunit results in conformational changes that modulate helicase and primase activity. PMID: 19574219