Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3), partial

In Stock
Code CSB-EP319032EFA
Abbreviation Recombinant Epstein-Barr virus EBNA3 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
EBNA3
Uniprot No.
Research Area
Others
Alternative Names
EBNA3; BLRF3-BERF1Epstein-Barr nuclear antigen 3; EBNA-3; EBV nuclear antigen 3; Epstein-Barr nuclear antigen 3A; EBNA-3A; EBV nuclear antigen 3A
Species
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Source
E.coli
Expression Region
1-138aa
Target Protein Sequence
MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3) is expressed in E. coli and comprises amino acids 1-138. The protein comes with an N-terminal 10xHis tag and a C-terminal Myc tag, which makes purification and detection more straightforward. It reaches a purity of over 85%, as verified by SDS-PAGE. This product is intended for research use only and is not for use in diagnostic or therapeutic applications.

EBNA3 is a nuclear antigen from the Epstein-Barr virus that appears to play a crucial role in regulating viral and cellular gene expression. It seems to be involved in modulating host cell processes and likely contributes to the virus's ability to establish latency. Research involving EBNA3 may be essential for understanding Epstein-Barr virus pathogenesis and the mechanisms underlying viral persistence and oncogenic transformation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant EBNA3 fragment is expressed in E. coli, a prokaryotic system that is fundamentally unsuitable for producing functional eukaryotic viral proteins like EBNA3. EBNA3 is a complex nuclear antigen that requires precise folding, nuclear localization, and specific post-translational modifications for its transcriptional regulatory functions. The expressed fragment (1-138aa) represents only a small N-terminal portion of the full-length protein and contains dual tags (N-terminal 10xHis and C-terminal Myc) that may interfere with proper folding. E. coli lacks the eukaryotic chaperones and modification machinery necessary for the correct folding of this viral protein. Since activity is unverified and the expression system is mismatched for this complex eukaryotic protein, the protein is highly likely to be misfolded and inactive without experimental validation.

1. Antibody Development and Validation

The recombinant EBNA3 fragment can serve as an effective immunogen for generating antibodies that recognize linear epitopes within the 1-138aa region, even if the EBNA3 protein is misfolded. The dual tags facilitate purification and detection. However, antibodies may not recognize conformational or modification-dependent epitopes of full-length, properly folded EBNA3 in infected cells. Validation against native EBNA3 from EBV-infected cells is essential.

2. Protein-Protein Interaction Studies

This application is high-risk without folding validation. While the His-tag enables technical feasibility for pull-down assays, if the EBNA3 fragment is misfolded (as expected in E. coli), it will not interact physiologically with true binding partners. The fragment represents only a small portion of the full protein and may lack complete functional domains. Identified interactions are likely to be non-physiological artifacts. This application should not be pursued without confirmation of proper folding.

3. ELISA-Based Binding Assays

This application should be approached with caution. If the EBNA3 fragment is misfolded, binding assays will not reflect biological reality. The tags enable technical development of ELISA formats, but results may be misleading without proper folding validation. This application requires prior demonstration of proper folding and specific binding capability.

4. Biochemical Characterization Studies

This application is well-suited for assessing the recombinant EBNA3 protein itself. Techniques like size-exclusion chromatography and circular dichroism spectroscopy can evaluate the protein's physical properties. However, these studies characterize the E. coli-expressed EBNA3 fragment and may not reflect the behavior of native, full-length EBNA3.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this complex viral protein fragment, we recommend first performing biophysical characterization (circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) to assess folding quality. Antibody development can proceed as the safest application. Avoid all functional studies (interactions, binding assays) until proper folding is validated. For reliable EBNA3 research, obtain full-length protein from eukaryotic expression systems capable of proper folding and post-translational modifications. Always validate findings with native EBNA3 from EBV-infected cells when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.
Gene References into Functions
  1. the polycomb repressor complex is essential for EBNA3A-mediated repression of STK39 Findings in this study provide new insights into the regulation of cellular genes by the transcription factor EBNA3A. PMID: 29367247
  2. These results indicate that EBNA3 proteins interact with multiple RBP/CSL domains, but only N-terminal domain interactions are required for lymphoblastoid cell line growth. PMID: 21440926
  3. EBNA-3 plays a role in facilitating the ligand-dependent AhR activation process PMID: 16257957
Subcellular Location
Host nucleus matrix. Note=Associated with the nuclear matrix.
Protein Families
Herpesviridae EBNA-3 family
Database Links

KEGG: vg:3783762

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*