Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

fabB

Uniprot No.

P0A953

Alternative Names

fabB; fabC; b2323; JW23203-oxoacyl-[acyl-carrier-protein] synthase 1; EC 2.3.1.41; 3-oxoacyl-[acyl-carrier-protein] synthase I; Beta-ketoacyl-ACP synthase I; KAS I

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

1-406aa

Target Protein Sequence

MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

61.3kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-406 form the expressed segment for recombinant Escherichia coli (strain K12) fabB. This fabB protein is theoretically predicted to have a molecular weight of 61.3 kDa. The fabB protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag and C-terminal Myc tag was smoothly integrated into the coding gene of fabB, which enables a simple process of detecting and purifying the fabB recombinant protein in the following steps.

3-oxoacyl-[acyl-carrier-protein] synthase 1 (FabB) in Escherichia coli is an essential enzyme involved in fatty acid biosynthesis, a critical cellular process for the production of phospholipids, lipopolysaccharides, and energy storage molecules. FabB catalyzes the condensation of malonyl-acyl carrier protein (ACP) with acetyl-CoA, leading to the elongation of fatty acid chains. This enzyme is part of the type II fatty acid synthesis system in bacteria, distinct from the eukaryotic type I system. The elongation of fatty acids is crucial for the formation of the lipid bilayer in bacterial membranes. Understanding the function of FabB is essential for unraveling bacterial lipid metabolism and can have implications for the development of antimicrobial agents targeting fatty acid biosynthesis.

Target Background

Function

Involved in the type II fatty acid elongation cycle. Catalyzes the elongation of a wide range of acyl-ACP by the addition of two carbons from malonyl-ACP to an acyl acceptor. Can also use unsaturated fatty acids. Catalyzes a key reaction in unsaturated fatty acid (UFA) synthesis, the elongation of the cis-3-decenoyl-ACP produced by FabA. Can use acyl chains from C-6 to C-14. Has an absolute requirement for an ACP substrate as the acyl donor, and no activity is detected when both substrates are based on CoA.

Subcellular Location

Cytoplasm.

Protein Families

Beta-ketoacyl-ACP synthases family

Database Links

KEGG: ecj:JW2320

STRING: 316385.ECDH10B_2485

Code	CSB-EP359247ENV
Abbreviation	Recombinant E.coli fabB protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP359247ENVa3 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fabB. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP359247ENVa3 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fabB.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage