Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB)

In Stock Promotion
Code CSB-EP359247ENV
MSDS
Size US$388
Order now
Promotion
Promotional price as low as $99
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP359247ENVa3 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fabB.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP359247ENVa3 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fabB.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
fabB
Uniprot No.
Alternative Names
fabB; fabC; b2323; JW23203-oxoacyl-[acyl-carrier-protein] synthase 1; EC 2.3.1.41; 3-oxoacyl-[acyl-carrier-protein] synthase I; Beta-ketoacyl-ACP synthase I; KAS I
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-406aa
Target Protein Sequence
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
61.3kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 1-406 form the expressed segment for recombinant Escherichia coli (strain K12) fabB. This fabB protein is theoretically predicted to have a molecular weight of 61.3 kDa. The fabB protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag and C-terminal Myc tag was smoothly integrated into the coding gene of fabB, which enables a simple process of detecting and purifying the fabB recombinant protein in the following steps.

3-oxoacyl-[acyl-carrier-protein] synthase 1 (FabB) in Escherichia coli is an essential enzyme involved in fatty acid biosynthesis, a critical cellular process for the production of phospholipids, lipopolysaccharides, and energy storage molecules. FabB catalyzes the condensation of malonyl-acyl carrier protein (ACP) with acetyl-CoA, leading to the elongation of fatty acid chains. This enzyme is part of the type II fatty acid synthesis system in bacteria, distinct from the eukaryotic type I system. The elongation of fatty acids is crucial for the formation of the lipid bilayer in bacterial membranes. Understanding the function of FabB is essential for unraveling bacterial lipid metabolism and can have implications for the development of antimicrobial agents targeting fatty acid biosynthesis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the type II fatty acid elongation cycle. Catalyzes the elongation of a wide range of acyl-ACP by the addition of two carbons from malonyl-ACP to an acyl acceptor. Can also use unsaturated fatty acids. Catalyzes a key reaction in unsaturated fatty acid (UFA) synthesis, the elongation of the cis-3-decenoyl-ACP produced by FabA. Can use acyl chains from C-6 to C-14. Has an absolute requirement for an ACP substrate as the acyl donor, and no activity is detected when both substrates are based on CoA.
Subcellular Location
Cytoplasm.
Protein Families
Beta-ketoacyl-ACP synthases family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*