Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
fabB; fabC; b2323; JW23203-oxoacyl-[acyl-carrier-protein] synthase 1; EC 2.3.1.41; 3-oxoacyl-[acyl-carrier-protein] synthase I; Beta-ketoacyl-ACP synthase I; KAS I
Species
Escherichia coli (strain K12)
Expression Region
1-406aa
Target Protein Sequence
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-406 form the expressed segment for recombinant Escherichia coli (strain K12) fabB. This fabB protein is theoretically predicted to have a molecular weight of 61.3 kDa. The fabB protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag and C-terminal Myc tag was smoothly integrated into the coding gene of fabB, which enables a simple process of detecting and purifying the fabB recombinant protein in the following steps.
3-oxoacyl-[acyl-carrier-protein] synthase 1 (FabB) in Escherichia coli is an essential enzyme involved in fatty acid biosynthesis, a critical cellular process for the production of phospholipids, lipopolysaccharides, and energy storage molecules. FabB catalyzes the condensation of malonyl-acyl carrier protein (ACP) with acetyl-CoA, leading to the elongation of fatty acid chains. This enzyme is part of the type II fatty acid synthesis system in bacteria, distinct from the eukaryotic type I system. The elongation of fatty acids is crucial for the formation of the lipid bilayer in bacterial membranes. Understanding the function of FabB is essential for unraveling bacterial lipid metabolism and can have implications for the development of antimicrobial agents targeting fatty acid biosynthesis.