Recombinant Escherichia coli Fe/S biogenesis protein NfuA (nfuA),Biotinylated

In Stock
Code CSB-EP540344ENT-B
Abbreviation Recombinant E.coli nfuA protein, Biotinylated
MSDS
Size $466
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
nfuA
Uniprot No.
Research Area
Others
Species
ENT-Escherichia coli (strain K12 / DH10B)
Source
E.coli
Expression Region
1-191aa
Target Protein Sequence
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.8 kDa
Protein Length
Full Length
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Fe/S biogenesis protein NfuA is produced in E. coli and contains the complete protein sequence from amino acids 1 to 191. The construct includes an N-terminal maltose-binding protein (MBP) tag and a C-terminal 6xHis-Avi tag, which appears to improve solubility and enable affinity purification. The protein undergoes biotinylation and shows a purity level above 85% when analyzed by SDS-PAGE, suggesting it should work well for controlled experimental work.

NfuA likely plays a key role in building iron-sulfur (Fe/S) clusters—cofactors that many cellular processes depend on. This protein seems to help assemble and deliver Fe/S clusters to their target proteins, making it important for cellular iron balance and metabolic function. Because of its involvement in these pathways, NfuA has become an interesting focus for researchers studying bacterial physiology and biochemistry.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Escherichia coli Fe/S biogenesis protein NfuA is a bacterial protein that requires precise folding and iron-sulfur cluster binding for its functional activity in Fe/S cluster assembly and transfer. The E. coli expression system is homologous to this bacterial protein, significantly increasing the probability of correct folding. However, the large N-terminal MBP tag (∼40 kDa) may sterically interfere with the protein's functional domains or interaction interfaces, while the C-terminal biotinylation could potentially affect the protein's C-terminal region. While the protein may be correctly folded, the large tags require experimental validation to confirm functional activity.

1. Protein-Protein Interaction Studies Using Biotin-Streptavidin Capture

This application is conditionally suitable but requires validation. The biotin-streptavidin system provides strong binding for capture experiments, but the large MBP tag may sterically hinder physiological protein interactions. If correctly folded and active (verified), the protein can identify genuine Fe/S cluster pathway partners. If misfolded/tag-interfered (unverified), there is a risk of non-specific binding or interaction failure.

2. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition. The full-length protein provides comprehensive epitope coverage, though antibodies may primarily recognize the large MBP tag rather than the NfuA domain if not properly screened.

3. Comparative Biochemical Analysis of Fe/S Biogenesis Proteins

This application requires careful interpretation. The large MBP tag significantly alters the protein's hydrodynamic properties, making direct biophysical comparisons with untagged proteins challenging. If correctly folded (verified), limited comparisons are possible, but tag effects must be considered. The MBP tag's size dominates biophysical properties, complicating direct comparisons with native proteins.

4. ELISA-Based Detection and Quantification Assays

The multiple tags provide excellent flexibility for assay development regardless of native folding. This application is highly suitable due to the versatile tag system. The biotin tag enables efficient streptavidin plate coating, while the His tag provides an alternative capture method. The MBP tag offers additional epitopes for detection antibodies.

Final Recommendation & Action Plan

The homologous E. coli expression system provides favorable conditions for this bacterial Fe/S cluster protein, but the large MBP tag and biotinylation require experimental validation before reliable use in functional interaction studies. Begin with biochemical characterization to assess folding quality through size-exclusion chromatography and validate Fe/S cluster binding activity. Applications 2 and 4 (antibody development and ELISA) can proceed immediately due to their reliance on tag functionality rather than native protein structure. For Application 1, first validate that the tags do not interfere with physiological interactions by testing known binding partners. For Application 3, interpret comparative data with caution due to the MBP tag's dominant effect on biophysical properties. Consider tag removal or using minimal-tag constructs for critical functional studies requiring authentic protein behavior.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.
Protein Families
NfuA family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*