Recombinant Escherichia coli Methyl-accepting chemotaxis protein II (tar), partial

Code CSB-EP356999ENV
Abbreviation Recombinant E.coli tar protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
tar
Uniprot No.
Research Area
Others
Alternative Names
tar; cheM; b1886; JW1875Methyl-accepting chemotaxis protein II; MCP-II; Aspartate chemoreceptor protein
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
212-553aa
Target Protein Sequence
IRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASPLTNKPQTPSRPASEQPPAQPRLRIAEQDPNWETF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.0kDa
Protein Length
Cytoplasmic Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the attractant L-aspartate and related amino and dicarboxylic acids. Tar also mediates taxis to the attractant maltose via an interaction with the periplasmic maltose binding protein. Tar mediates taxis away from the repellents cobalt and nickel.; Chemotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and removed by the methylesterase CheB.
Gene References into Functions
  1. Thus, the proportion of polypeptide chain that is locally and presumably transiently disordered is a structural feature of cytoplasmic domain dynamics that varies with functional region and modification-induced signaling state. PMID: 27318193
  2. There is a differential repositioning of the second transmembrane helices from E. coli Tar and EnvZ upon moving the flanking aromatic residues. PMID: 25445668
  3. the Tar(FO) modules demonstrate that trimerized signaling tips self-associate, bind CheA and CheW, and facilitate conversion of CheA to an active conformation. PMID: 25967982
  4. Residues at the cytoplasmic end of transmembrane helix 2 determine the signal output of the Tar chemoreceptor. PMID: 23495653
  5. Such inversion is enabled by opposing pH sensing by the two major chemoreceptors, Tar and Tsr, such that the relative strength of the response is modulated by adaptive receptor methylation. PMID: 23078189
  6. Here we report the overexpression system for aCB2 in Escherichia coli C43(DE3) facilitated by two fusion partners: Mistic and TarCF, a C-terminal fragment of the bacterial chemosensory transducer Tar at the C-terminal of the CB2 open reading frame region. PMID: 22406258
  7. characterization of structural features of carboxyl-terminal 40 residues of Tar; identifed carboxyl-terminal linker between receptor body and the pentapeptide is an unstructured, disordered segment that can serve as a flexible arm and enzyme tether PMID: 21858888
  8. Ligand specificity is determined by differentially arranged common ligand-binding residues in bacterial amino acid chemoreceptors Tsr and Tar PMID: 21979954
  9. Tar molecules with the cytoplasmic methylation and kinase control domains of Tsr still sensed phenol as an attractant. PMID: 21965561
  10. The cytoplasmic domains of Tar and Tsr receptors are close to each other near the trimer contact region at the cytoplasmic tip. PMID: 21174433
  11. These results with Tar-EnvZ hybrid receptor mutants suggest that intersubunit interactions in the HAMP linker normally mediate signal transduction through both subunits in a sensor dimer. PMID: 15316026
  12. mutations in the protein motifs of Tar significantly reduced the ability of the transmembrane domains to dimerize PMID: 15330757
  13. The tryptophan residues flanking the second transmembrane helix of Tar, especially Trp-209, are crucial in setting the baseline activity and ligand sensitivity of this chemoreceptor. PMID: 15667220
  14. assisted adaptational modification (methylation, demthylation and deamidation) in vitro of Trg chemorecptor PMID: 15916610
  15. polar localization of Tar fused to green fluorescent protein is influenced by its own amidation (methylation) state and the expression of another chemoreceptor (Tsr) PMID: 16267289
  16. Data show that Tar can be readily mutated to respond to new chemical signals, but that the overall change in specificity depends on the target compound. PMID: 16359703
  17. The pentapeptide linker in Tar is important for chemotaxis because of its role in adaptational modification. PMID: 16573695
  18. The fundamental mechanism of transmembrane signaling is conserved between homodimeric sensor kinases (with NarX) and chemoreceptors. PMID: 16707686
  19. Data suggest that Tar()-Tsr* suppression most likely occurs through compensatory changes in the conformation or dynamics of a mixed receptor signaling complex, presumably based on trimer-of-dimer interactions. PMID: 16751275
  20. The organization of these receptor/signaling complexes is determined by conserved interactions between the constituent chemotaxis proteins and may represent the active form in vivo. PMID: 16973743
  21. A mutational analysis of Tar residues 505-548 reveals that the more of this region is deleted, the less sensitive Tar is to inhibition by aspartate. PMID: 19053273

Show More

Hide All

Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Note=Found predominantly at cell poles.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*