Recombinant Escherichia coli Nickel-responsive regulator (nikR)

In Stock
Code CSB-EP363929ENV
Abbreviation Recombinant E.coli nikR protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
nikR
Uniprot No.
Research Area
Others
Alternative Names
nikR; yhhG; b3481; JW3446Nickel-responsive regulator
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-133aa
Target Protein Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Nickel-responsive regulator (nikR) is produced using an E. coli expression system and contains the full-length protein spanning 1-133 amino acids. The recombinant protein includes an N-terminal 6xHis-tag, which helps with purification and detection processes. SDS-PAGE analysis confirms a purity level greater than 90%. This product is intended for research use only and comes without endotoxin level specifications.

NikR appears to function as a transcriptional regulator in Escherichia coli, with its primary role being nickel ion homeostasis. The protein works by binding to DNA in response to nickel ion concentration, which then regulates the expression of genes linked to nickel uptake and usage. This protein likely plays a crucial role in maintaining cellular metal ion balance, making it an important focus for bacterial metal ion regulation research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-DNA Interaction Studies Using Electrophoretic Mobility Shift Assays (EMSA)

Researchers can use the recombinant nikR protein to investigate its DNA-binding properties through EMSA experiments with potential nickel-responsive promoter sequences. As a nickel-responsive regulator, this protein may bind to specific DNA sequences when nickel ions are present or absent. This makes it well-suited for studying metal-dependent transcriptional regulation mechanisms. The N-terminal 6xHis tag allows for straightforward purification and handling. The >90% purity should be sufficient for reliable DNA-binding assays, and these studies might help clarify the molecular basis of nickel homeostasis regulation in E. coli.

2. Metal Ion Binding Characterization Through Biophysical Analysis

The nikR protein can serve as a model system for studying nickel-binding properties using techniques such as isothermal titration calorimetry (ITC) or differential scanning fluorimetry (DSF). Given its role as a nickel-responsive regulator, the protein probably undergoes conformational changes upon metal binding that researchers can monitor and quantify. The high purity level makes it appropriate for sensitive biophysical measurements to determine binding stoichiometry, affinity constants, and thermodynamic parameters. These experiments may provide insights into the specificity and mechanism of nickel recognition by bacterial regulatory proteins.

3. Antibody Development and Immunoassay Applications

Researchers can use the recombinant nikR protein as an immunogen for generating polyclonal or monoclonal antibodies specific to E. coli nikR. The >90% purity and N-terminal His-tag help with both immunization protocols and subsequent antibody validation through His-tag based capture assays. These antibodies could become valuable research tools for studying nikR expression levels, cellular localization, and protein-protein interactions in bacterial systems. The purified protein can also serve as a positive control and standard in various immunoassays including Western blotting and ELISA.

4. Protein-Protein Interaction Screening Using His-Tag Pull-Down Assays

The N-terminal 6xHis tag allows researchers to use this nikR protein in pull-down experiments to identify potential protein interaction partners from E. coli cell lysates or purified protein libraries. Scientists can immobilize the protein on nickel-affinity resins and use it to capture interacting proteins, which can then be identified through mass spectrometry analysis. This approach appears particularly valuable for discovering regulatory networks and protein complexes involved in nickel homeostasis. The high purity should minimize background binding and lead to more reliable identification of specific interaction partners.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel.
Gene References into Functions
  1. Structural basis of low-affinity nickel binding to the nickel-responsive transcription factor NikR from Escherichia coli PMID: 20704276
  2. localized this Ni(II) site to a region at the interface between the metal- and DNA-binding domains and identified His48 and His110 as residues that participate in the low-affinity Ni(II)-binding response PMID: 20583753
  3. Mutagenesis and cation exchange experiments reveal that K(+) is a critical structural component for the activation of Ni(II)-responsive DNA binding by NikR. PMID: 20088519
  4. This data sheds light on the Ni(II)-selective conformational changes that allow NikR to bind DNA optimally and repress transcription of the nik operon. PMID: 16133200
  5. Two crystal structures of nickel-activated E. coli NikR were reported. PMID: 16945905
  6. NikR response is specific to nickel in vivo. PMID: 17397155
  7. Results examine a series of residue interrelationships that describe an allosteric communication pathway between the Ni(2+)- and DNA-binding sites of NikR, which are separated by 40 A. PMID: 18433769

Show More

Hide All

Protein Families
Transcriptional regulatory CopG/NikR family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*