Recombinant Escherichia coli Prophage outer membrane lipoprotein RzoR (rzoR)

In Stock
Code CSB-EP349921ENVg1
Abbreviation Recombinant E.coli rzoR protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
rzoR
Uniprot No.
Research Area
Others
Alternative Names
rzoR; b4528; JW5213; Prophage outer membrane lipoprotein RzoR; o-spanin; Outer membrane lipoprotein Rz1 from lambdoid prophage Rac; Spanin from lambdoid prophage Rac; outer membrane subunit
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
20-61aa
Target Protein Sequence
CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-Flag-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Prophage outer membrane lipoprotein RzoR is produced using an E. coli expression system and carries an N-terminal 6xHis-Flag tag. The protein appears to be expressed as the full length mature form, covering amino acid region 20-61. SDS-PAGE analysis shows the product reaches purity levels above 85%, which should provide reliable results for research applications.

RzoR is a prophage outer membrane lipoprotein found in Escherichia coli, particularly within the K12 strain. It seems to play a role in how phage particles organize structurally, contributing to both stability and assembly of phage components. Studying RzoR may offer insights into bacterial phage biology - research that could prove valuable for understanding microbial genetics and developing phage therapy approaches.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

E. coli RzoR is a prophage-encoded outer membrane lipoprotein that requires precise folding, proper N-terminal lipidation (cysteine acylation with diacylglycerol), membrane integration, and specific tertiary structure for its functional role in prophage-mediated lysis. The standard E. coli expression system cannot provide the essential lipidation machinery required for proper membrane localization and function. While the protein region (20-61aa, 42 amino acids) represents the full-length mature protein after signal peptide cleavage, the lack of lipidation at the N-terminal cysteine (typically Cys20) means the protein cannot form its native structure or function properly. The dual N-terminal 6xHis-Flag tag further disrupts the protein's natural structure and prevents membrane association.

1. Antibody Development and Immunological Studies

This application has severe limitations. While antibodies can be generated, they will primarily target the foreign tags and linear epitopes. Antibodies may not recognize the native, lipidated, membrane-integrated RzoR protein due to the critical structural differences between the lipidated and non-lipidated forms.

2. Structural and Biophysical Characterization

Basic biophysical analysis can be performed but will not reflect native RzoR structure. The lack of lipidation means the protein will adopt a solution structure completely different from the membrane-associated native form. Results will describe an artificial construct rather than the physiological lipoprotein.

3. ELISA-Based Quantitative Assays

This application is feasible for detecting the recombinant RzoR protein, but is biologically irrelevant for native RzoR. Assays will measure the tagged, non-lipidated protein, which has different epitopes and a structure than the native membrane-associated RzoR. Quantitative data will not correlate with physiological RzoR expression.

Final Recommendation & Action Plan

This recombinant RzoR is unsuitable for functional studies despite being the full-length mature protein sequence, because the essential N-terminal lipidation required for lipoprotein function is absent in this expression system. The His-Flag tag replaces the natural lipid anchor at Cys20, creating a soluble protein that cannot integrate into membranes or function in lysis mechanisms. Interaction studies and functional studies should be avoided entirely. For reliable RzoR research, study the natively expressed, lipidated protein in its membrane context using specialized lipoprotein expression systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans.
Subcellular Location
Cell outer membrane; Lipid-anchor; Periplasmic side.
Protein Families
Lambdalikevirus o-spanin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*