Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
rzoR; b4528; JW5213; Prophage outer membrane lipoprotein RzoR; o-spanin; Outer membrane lipoprotein Rz1 from lambdoid prophage Rac; Spanin from lambdoid prophage Rac; outer membrane subunit
Species
Escherichia coli (strain K12)
Expression Region
20-61aa
Target Protein Sequence
CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
In the general approach to express the recombinant Escherichia coli (strain K12) rzoR protein, a plasmid encoding the Escherichia coli (strain K12) rzoR protein (20-61aa) is first constructed. The constructed plasmid is then introduced into e.coli cells. Plasmid-containing e.coli cells are screened and cultured under conditions that induce the protein expression. The protein is fused with a N-terminal 6xHis-KSI tag. Lysing the cultured cells and purifying the resulting recombinant rzoR protein through affinity purification. The SDS-PAGE analysis is conducted to confirm the presence of the recombinant rzoR protein and assess its purity. Its purity is over 85%.